#TheGreatAmericanTakeout Participants
 Share
The version of the browser you are using is no longer supported. Please upgrade to a supported browser.Dismiss

 
$
%
123
 
 
 
 
 
 
 
 
 
ABCDEFGHIJKLMNOPQRSTUVWXYZAA
1
Barbecuepittsburgh pa 15216TwitterFACEBOOKEmail315-214-3007Website
TOWN TAVERN 2119 BREWERTON RD MATTYDALE NY 13211 315 214 3007
2
Thaicafe1177 Park Ave Orange park FL jakkrapat@yahoo.com 904-5410204www.thaicafeorangepark.com
3
1205 Sheffield Avenue Dyer, IN 46311@bozhotdogscarol@eatbozhotdogs.com
4
Mr. Subb #101558 Central Avenue Albany, NY 12205@mrsubb@mrsubbmrsubb@mrsubb.com(518) 869-7970http://www.mrsubb.com
5
Monterey Grill
1665 Dunlawton Blvd #101, Port Orange, Fl 32127
@montereygrill_1665thomas.knutelski@montereygrill.net386-761-6868www.montereygrill.net
6
Pizza Mania
1734 Bruce B Downs blvd, Wesley Chapel, Florida 33544
@mypizzamania(813) 907-0005www.mypizzamania.com
7
Mr. Subb #16
1870 Altamont Avenue Rotterdam, NY 12303
@mrsubb@mrsubbmrsubb@mrsubb.com(518) 356-8077http://www.mrsubb.com
8
KFC1900 Colonel Sanders Ln, Louisville KY@KFC@KFCrachel.gonzalez@yum.comkfc.om
9
Mr. Subb #092005 Western Avenue Albany, NY 12203@mrsubb@mrsubbmrsubb@mrsubb.com(518) 456-8790http://www.mrsubb.com
10
Mr. Subb #20
222 Guideboard Road Halfmoon, NY 12065
@mrsubb@mrsubbmrsubb@mrsubb.com(518) 383-2422http://www.mrsubb.com
11
PEDRO'S MEXICAN & SEAFOOD
2260 E PALMDALE BLVD STE A, PALMDALE CA
@PEDRO'S661-265-9773
12
Mr. Subb #04
23 E Lower Hudson Ave Green Island, NY 12183
@mrsubb@mrsubbmrsubb@mrsubb.com(518) 273-7993http://www.mrsubb.com
13
Boz Hot Dogs2513 Ridge Road Lansing, IL 60438@bozhotdogscarol@eatbozhotdogs.com(708) 895-8515
14
Aba2611 Monroe Street, Madison, WI 53711@abarestaurantsabacs@leye.comwww.abarestaurants.com
15
Mr. Subb #183 Troy Road East Greenbush, NY 12061@mrsubb@mrsubbmrsubb@mrsubb.com(518) 477-5461http://www.mrsubb.com
16
Pollo Feliz3120 w 26th Chicago@PolloFelizUSAPolloFelizUSAboxmail@PolloFelizUSA.com773-847-7712PolloFelizUSA.com
17
ProteinHouse3141 E. Indian School Rd. Suite 111@proteinhousephxjodi@pharizona1.com602-354-5400https://www.protein-house.com/
18
Mr. Subb #13
352 Northern Boulevard Albany, NY12204
@mrsubb@mrsubbmrsubb@mrsubb.com(518) 436-7571http://www.mrsubb.com
19
Alfie's Fish & Chips
3624 Ryan Street Lake Charles LA 70605
@alfiesfishandchipschelseammckinney@gmail.com805-736-0154www.alfiesfish.com
20
Gateway Grill
4251 Northern Pike Monoroeville Pa 15146
@gatewaygrill412-372-2977www.gatewaygrill.net
21
Mr. Subb #01463 Second Avenue Troy NY 12182@mrsubb@mrsubbmrsubb@mrsubb.com(518) 235-6857http://www.mrsubb.com
22
Palermo Pizza Alpine
4669 Alpine Ave.. NW Comstock Park, MI 49321
@palermo pizza - Alpine616-647-2800
23
Mr. Subb #03
469 Albany Shaker Road Loudonville, NY 12211
@mrsubb@mrsubbmrsubb@mrsubb.com(518) 458-1122http://www.mrsubb.com
24
Bella Luna Trattoria5060 William Penn Hwy Monoroeville pa@BellaLunaMonoroeville724-733-2662www.yourbellaluna.com
25
Mr. Subb #05539 Pawling Avenue Troy, NY 12180@mrsubb@mrsubbmrsubb@mrsubb.com(518) 273-0648http://www.mrsubb.com
26
Mr. Subb #08
54 Crossing Blvd, Suite J Clifton Park, NY 12065
@mrsubb@mrsubbmrsubb@mrsubb.com(518) 371-4464http://www.mrsubb.com
27
Mr. Subb #06546 Hoosick Street Troy, NY 12180@mrsubb@mrsubbmrsubb@mrsubb.com(518) 272-2521http://www.mrsubb.com
28
Mr. Subb #19
579 Troy-Schenectady Road Latham, NY 12110
@mrsubb@mrsubbmrsubb@mrsubb.com(518) 786-0824http://www.mrsubb.com
29
Fiesta cancun mexican restaurant5817 Neal ave n oakpark heights mn@fiestacancun.mn(651) 342-1684Fiestacancunmn.com
30
Hogwood BBQ
600A Frazier Drive, Suite 100, Franklin, TN 37067
@hogwoodbbqe.yamanaka@hogwood.com615-807-1846www.hogwood.com
31
Charlie's Cafe 615 E. Main St. Burley Idaho @charlies83318208-678-0112www.facebook.com/charliescafeburley
32
Mr. Subb #07630 Columbia Street Latham, NY 12110@mrsubb@mrsubbmrsubb@mrsubb.com(518) 783-6251http://www.mrsubb.com
33
ProeinHouse7077 E. Mayo Blvd Suite B100@proteinhousephxjodi@pharizona1.com480-502-5183https://www.protein-house.com/
34
Fiesta cancun mexican restaurant7090 21sr ave n Lino lakes Mn @fiestacancun.mn(651) 888-6330 Fiestacancunmn.com
35
BIG WIG TACOS & BURRITOS770 N LASALLE ST@bigwigtacos312-624-9568bigwigtacos.com
36
Aroithai 820 LOMAX STREET JACKSONVILLE FLjakkrapat@yahoo.com 904-2564979
37
Samurai Restaurant8717 SW 136th Street, Miami, FL 33176@miamisamurai@miamisamuraisocial@samurai.com 305-238-2131https://samurairestaurant.com/
38
Munch Thai Food & Sweet Tea880 W Lincoln Ave, Anaheim CA 92805@munchthaifoodowners@munchthai.com714-956-2830www.munchthai.com
39
Mr. Subb #0290 Broad Street Waterford, NY 12188@mrsubb@mrsubbmrsubb@mrsubb.com(518) 687-2236http://www.mrsubb.com
40
George's Drive In9910 Magnolia Ave, Riverside, CA 92503@georgesdrivein951-688-2471https://www.georgesdrivein.com
41
1000 NorthActon@1000_north@1000.north561-570-1000https://www.1000north.com/
42
Andria’s Seafood Restaurant & MarketAl Locations@andriasseafoodrestaurant(805) 654-0546andriasseafood.com
43
Antico PostoAll Illinois Locations@anticopostowww.antico-posto.com
44
Antonio RistoranteAll Locations@Antonioristoran@Ristoranteantonio
45
BenihanaAll locations@benihana@benihanasocial@benihana.comFind the location nearest you: www.benihana.com/locationswww.benihana.com
46
Firehouse SubsAll Locations@firehousesubs@firehousesubs
Find location nearest you at www.firehouse subs.com
www.firehousesubs.com
47
RA SushiAll Locations@rasushi@rasushisocial@rasushi.com Find the location nearest you:
https://rasushi.com/locations/
www.rasushi.com
48
Antonio's RestaurantAll Locations -- NY & CAlaura@antoniosbarandgrill.com843-281-0620www.antoniosrestaurantandbar.com
49
Applebee’sAll Missouri Location@Applebees@Applebees
50
Artichoke PizzaApple Valley@artichokepizzatamara@ajendapr.comhttps://www.artichokepizza.com
51
Auntie Anne'sApple Valley@AuntieAnnesPretzels@AuntieAnnesPretzelsMBauer@AuntieAnnes.com7174399960AuntieAnnes.com
52
Bad Daddy’s BurgersApple Valley@bahamabreeze@bahamabreezeislandgrilleVbachtel@bahamabreeze.com412-788-5790Www.bahamabreeze.com
53
Baja FreshAtlanta GAdd@boldbajafresh
54
Balkan Treat BoxAtlanta GA@balkantreatboxhttp://www.balkantreatbox.com/keep-in-touch-2(314) 733-5700balkantreatbox.com
55
Barcelona Wine BarAtlanta, GA@barcelonawineba@barcelonawinebarbarcelonawinebar.com/
56
bartacoAtlanta, GA@bartacolife@bartacolifebartaco.com
57
Beach Harbor Pizza Atlanta, GA@beachharborpizza(949) 218-1920https://beachharborpizza.com/
58
El PonceAtlanta, GA@elponceatl@elponceatlhttps://www.elponce.com
59
Sipping Sisters Cafe Avondale Arizona Sippingsisterscafe@gmail.com623 248 0251
60
BeachcomberBabson Park@_Beachcomber_@beachcomberstaugustine Beachcomberstaugustine@gmail.com904-471-3744www.beachcomberstaugustine.com
61
Beatrix Baker@beatrixrestaurantsbeatrixstreetervillecs@leye.comwww.beatrixrestaurants.com
62
BeefsteakBanning@beefsteak@beefsteakveggies
63
Bella Bru CafeBanning@bellabrucafemike@lunaloungeandbar.com916-485-2883bellabrucafe.com
64
Ben's Kosher Delicatessen Restaurant & CaterersBarstow@bensdeli@bensdelibocaraton@bensdeli.net561-470-9963www.bensdeli.net
65
BERTUCCI'S BRICK OVEN PIZZA & PASTABarstow@bertuccis@bertuccisskronolm@regancomm.comwww.bertuccis.com
66
Big BowlBermuda Dunes@bigbowlbuzz@bigbowlbuzzlnessel@leye.com847-903-1385www.bigbowl.com
67
Big ChickenBethesda, MD@bigchickenshaq@bigchickenshaqpr@bigchicken.combigchicken.com
68
Billy Goat Coffee CafeBig Bear City@billygoatcoffeecafe
69
Bistro JupiterBishop@BistroJupiter@BistroJUpiterthebistrojupiter@msn.com561-744-5054www.thebistrojupiter.com
70
Black Bear Dinerbowling green va @BlackBearDiner@BlackBearDiner
71
Blaze PizzaBoynton Beach, FL@blazepizza @blazepizza
72
Blimpie Bradenton, FL@blimpie
73
Bob EvansBrentwood, TN@bobevansfarms@bobevansfarmshttps://www.bobevans.com
74
Evelyn's Wine Bar & BistroBuffalo, Minnesota@evelynswinebarcontact@evelynswinebar.com763-682-8989www.evelynswinebar.com
75
Bok Bok Mediterranean Burbank, CA@eatbokbok@eatbokbokinfo@bokbokchicken.comhttps://bokbokchicken.com/
76
BolayCalifornia & Texas@bolay@bolaymarketing@bolay.com833-EATBOLAYhttps://bolay.com/
77
Borgata Pizza Cafe California, Arizona, Nevada, Oklahoma, Florida, Tennessee, North Carolina, Idaho@borgatapizzacafe@borgatapizza
78
Boston MarketCambridge, MA@bostonmarket@bostonmarket
79
The Sunrise Cafe'Carlisle, PA@sunrisecafecarlisle223-212-5192www.sunrisecafecarlisle.com
80
BranchwaterCathedral City@branchwater_vickeryhttps://www.branchwater-vickery.com
81
Buffalo Wild WingsCathedral City574-516-1011www.buffalowildwings.com
82
Carbone's PIzzeriaCenterville, MN@carbonescentvle@carbonespizzacentervilleroepizza@yahoo.com651-653-7755www.carbones.com
83
BurgerFiCherry Creek, COwww.burgerfi.com
84
Burtons Grill & BarChicago@burtonsgrillcltparkroadigooch@burtonsgrill.com603-738-4399www.burtonsgrill.com
85
Cafe Ba-Ba-Reeba! (Lettuce Entertain You Restaurant)Chicago, IL@cafebabareeba@cafebabareebameersmarketing@leye.com312-388-7960https://www.cafebabareeba.com/
86
Cafe ChardonnayChicago, IL@cafechardonnayfrank@cafe-chardonnay.com561-627-2662www.cafechardonnay.com
87
Café Ficelle Chicago, IL@cafeficelleMeg@scofieldcatering.com8059413444Www.cafeficelle.com
88
Cafe GabbainoChicago, IL@CafeGabbianoFLcafe_gabbianomarc.grimaud@cafegabbiano.com9413491423http://cafegabbiano.com
89
Café Yumm!Chicago, IL@CafeYumm@cafe_yummhttps://www.cafeyumm.com/order
90
California Fish GrillChicago, IL@californiafishgrillwww.cafishgrill.com
91
California Pizza KitchenChicago, IL@calpizzakitchen@cpk
92
California TortillaChicago, IL + North Bethesda, MD@caltort@caltortkaren.dawit@californiatortilla.com
93
Captain Ds SeafoodChicago, IL + North Bethesda, MD + Santa Monica, CA@CaptainDs@CaptainDsbindi_menon@captainds.com615-613-5071www.captainds.com
94
Caroline's RestaurantChicago, Washington, DC@carolinesrestaurant200 Main St. Dubuque, IA 52001563-588-5595https://hoteljuliendubuque.com/dining/
95
Carr's Steakhousechino@carrssteakhousecarrsrestaurant@gmail.com270-247-1111www.carrssteakhouse.com
96
Carrow’s RestaurantsClarksville, MD@carrowstweets@officialcarrows
97
Carvel Ice CreamClarksville, MD@carvelicecream@carvelicecreammsharpless@focusbrands.com480-246-6071www.carvel.com
98
Casa Bella Prime Steak and SeafoodCleveland, OhioLook at our Facebook pagecopelandprivaye@yahoo.com805*340*1118casabellaventura.com
99
CastawayCleveland, Ohio@castawayburbank@castawayburbankcastawayburbank@srcmail.com818-848-6691www.castawayburbank.com
100
Clinton NJ@bajaburritocompany908-335-8175www.bajaburritoco.com
Loading...