[NORC OpenData] Nipah Virus Vaccine Candidates
 Share
The version of the browser you are using is no longer supported. Please upgrade to a supported browser.Dismiss

 
View only
 
 
ABCDEFGHIJKLMNOPQR
1
Epitope Epitope TypeExperiment TypeAntigen Source Protein NameEpitope starting PositionEpitope ending PositionAccession Number of antigen source proteinEpitope Source Organisms Name (Strain)Host NameEpitope Binding Allele NameAssay TypeReference TypePubMed IDsAnnotatorEmailReference Link
2
SIQTKFAPLinear peptideNucleoprotein317324Q9IK92Nipah henipavirusHomo sapiens, Sus scrofaDatabasesnehkhant@gmail.com
http://www.iedb.org/result_v3.php?cookie_id=f0baf4
3
SNRTQGELinear peptideNucleoprotein503509Q9IK92Nipah henipavirusHomo sapiens, Sus scrofaDatabasesnehkhant@gmail.com
http://www.iedb.org/result_v3.php?cookie_id=f0baf4
4
SPSAAELinear peptideNucleoprotein6166Q9IK92Nipah henipavirusHomo sapiens, Sus scrofaDatabasesnehkhant@gmail.com
http://www.iedb.org/result_v3.php?cookie_id=f0baf4
5
E533
Discontinuous peptide
Glycoprotein GQ9IK92Nipah henipavirusMus musculusDatabasesnehkhant@gmail.com
http://www.iedb.org/result_v3.php?cookie_id=f0baf4
6
NQILKPKLISYTLPVVGLinear peptideGlycoprotein G195211Q9IH62Nipah henipavirusOryctolagus cuniculusDatabasesnehkhant@gmail.com
http://www.iedb.org/result_v3.php?cookie_id=f0baf4
7
GTRKYKIKSNPLT
ANTIGENIC SITES
Fusion Protein3436Nipah virus (NiV)Homo sapiens, Sus scrofaresearch papermd.afzal294@gmail.com
https://ieeexplore.ieee.org/document/7835376/
8
MENYKTR
ANTIGENIC SITES
Fusion Protein7076Nipah virus (NiV)Homo sapiens, Sus scrofaresearch papermd.afzal294@gmail.com
https://ieeexplore.ieee.org/document/7835376/
9
IYKNNT
ANTIGENIC SITES
Fusion Protein9095Nipah virus (NiV)Homo sapiens, Sus scrofaresearch papermd.afzal294@gmail.com
https://ieeexplore.ieee.org/document/7835376/
10
EAMKNADNINKLK
ANTIGENIC SITES
Fusion Protein130142Nipah virus (NiV)Homo sapiens, Sus scrofaresearch papermd.afzal294@gmail.com
https://ieeexplore.ieee.org/document/7835376/
11
SIESTN
ANTIGENIC SITES
Fusion Protein144149Nipah virus (NiV)Homo sapiens, Sus scrofaresearch papermd.afzal294@gmail.com
https://ieeexplore.ieee.org/document/7835376/
12
LQETAEKT
ANTIGENIC SITES
Fusion Protein155162Nipah virus (NiV)Homo sapiens, Sus scrofaresearch papermd.afzal294@gmail.com
https://ieeexplore.ieee.org/document/7835376/
13
QDYATPMTNNM
ANTIGENIC SITES
Fusion Protein332342Nipah virus (NiV)Homo sapiens, Sus scrofaresearch papermd.afzal294@gmail.com
https://ieeexplore.ieee.org/document/7835376/
14
MNQSLQQSKDYIKEAQRL
ANTIGENIC SITES
Fusion Protein453470Nipah virus (NiV)Homo sapiens, Sus scrofaresearch papermd.afzal294@gmail.com
https://ieeexplore.ieee.org/document/7835376/
15
EKKRNTYSRLEDRRVRPTS
ANTIGENIC SITES
Fusion Protein509527Nipah virus (NiV)Homo sapiens, Sus scrofaresearch papermd.afzal294@gmail.com
https://ieeexplore.ieee.org/document/7835376/
16
KIGLVKGT
IEDB ANTIGENICITY
Fusion Protein3037Nipah virus (NiV)Homo sapiens, Sus scrofaresearch papermd.afzal294@gmail.com
https://ieeexplore.ieee.org/document/7835376/
17
KDIVIKMIP
IEDB ANTIGENICITY
Fusion Protein4957Nipah virus (NiV)Homo sapiens, Sus scrofaresearch papermd.afzal294@gmail.com
https://ieeexplore.ieee.org/document/7835376/
18
NGILTPIKGALEI
IEDB ANTIGENICITY
Fusion Protein7890Nipah virus (NiV)Homo sapiens, Sus scrofaresearch papermd.afzal294@gmail.com
https://ieeexplore.ieee.org/document/7835376/
19
EAVVKLQ
IEDB ANTIGENICITY
Fusion Protein150156Nipah virus (NiV)Homo sapiens, Sus scrofaresearch papermd.afzal294@gmail.com
https://ieeexplore.ieee.org/document/7835376/
20
KTVYVLTALQDY
IEDB ANTIGENICITY
Fusion Protein161172Nipah virus (NiV)Homo sapiens, Sus scrofaresearch papermd.afzal294@gmail.com
https://ieeexplore.ieee.org/document/7835376/
21
GQIIYVDLSYYIIVRVYFPILTEIQQAYIQELLPVS
IEDB ANTIGENICITY
Fusion Protein247290Nipah virus (NiV)Homo sapiens, Sus scrofaresearch papermd.afzal294@gmail.com
https://ieeexplore.ieee.org/document/7835376/
22
IGFCLITKRSVICNQD
IEDB ANTIGENICITY
Fusion Protein318333Nipah virus (NiV)Homo sapiens, Sus scrofaresearch papermd.afzal294@gmail.com
https://ieeexplore.ieee.org/document/7835376/
23
PRELVVSSHVPRFA
IEDB ANTIGENICITY
Fusion Protein354367Nipah virus (NiV)Homo sapiens, Sus scrofaresearch papermd.afzal294@gmail.com
https://ieeexplore.ieee.org/document/7835376/
24
AIGPPVFTDKVDISSQI
IEDB ANTIGENICITY
Fusion Protein434450Nipah virus (NiV)Homo sapiens, Sus scrofaresearch papermd.afzal294@gmail.com
https://ieeexplore.ieee.org/document/7835376/
25
LLESDSITGQIIYVDLSYYI
LINEAR EPITOPES
Fusion Protein247266Nipah virus (NiV)Homo sapiens, Sus scrofaresearch papermd.afzal294@gmail.com
https://ieeexplore.ieee.org/document/7835376/
26
AAQITAGVALYEAMKNADNI
LINEAR EPITOPES
Fusion Protein119138Nipah virus (NiV)Homo sapiens, Sus scrofaresearch papermd.afzal294@gmail.com
https://ieeexplore.ieee.org/document/7835376/
27
G436,P437, P438, V439, F440, T441, 442,V444,D445, I446, S447, S448, Q449,I450,S451,S452, 453, N454, Q455,S456,L457, Q458, Q459,S460, K461,D462,Y463,I464, K465, E466, A467,Q468,R469, L470, L471, D472
DISCONTINUOUS EPITOPE
Fusion ProteinNipah virus (NiV)Homo sapiens, Sus scrofaresearch papermd.afzal294@gmail.com
https://ieeexplore.ieee.org/document/7835376/
28
IQELLPVSFNNDNSEWB-cell epitopesNiV F293
Nipah virus (NiV) Nipah henipavirus (NeV)
Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pubmed/28756915
29
PVSFNNDNSEWISIVPB-cell epitopesNiV F298
Nipah virus (NiV) Nipah henipavirus (NeV)
Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pubmed/28756915
30
SVNYNSEGIAIGPPVFB-cell epitopesNiV F435
Nipah virus (NiV) Nipah henipavirus (NeV)
Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pubmed/28756915
31
VQELLPVSFNNDNSEWB-cell epitopesHeV F293
Nipah virus (NiV) Nipah henipavirus (NeV)
Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pubmed/28756915
32
PVSFNNDNSEWISIVPB-cell epitopesHeV F298
Nipah virus (NiV) Nipah henipavirus (NeV)
Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pubmed/28756915
33
TLLMIDNTTCTTVVLGB-cell epitopesHeV F408
Nipah virus (NiV) Nipah henipavirus (NeV)
Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pubmed/28756915
34
PKVSLIDTSSTITIPAB-cell epitopesNiV G107
Nipah virus (NiV) Nipah henipavirus (NeV)
Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pubmed/28756915
35
CPNPLPFREYRPISQGB-cell epitopesHeV G162
Nipah virus (NiV) Nipah henipavirus (NeV)
Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pubmed/28756915
36
YTLPINTREGVCITDPB-cell epitopesHeV G205
Nipah virus (NiV) Nipah henipavirus (NeV)
Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pubmed/28756915
37
VDPLRVQWRNNSVISRB-cell epitopesHeV G472
Nipah virus (NiV) Nipah henipavirus (NeV)
Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pubmed/28756915
38
IPRTMLEFRRNNAIAFB-cell epitopesNiV M189
Nipah virus (NiV) Nipah henipavirus (NeV)
Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pubmed/28756915
39
PRTMLEFRRNNAIAFNB-cell epitopesNiV M190
Nipah virus (NiV) Nipah henipavirus (NeV)
Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pubmed/28756915
40
IPRTMLEFRRNNAIAFB-cell epitopesNiV M189
Nipah virus (NiV) Nipah henipavirus (NeV)
Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pubmed/28756915
41
PRTMLEFRRNNAIAFNB-cell epitopesNiV M190
Nipah virus (NiV) Nipah henipavirus (NeV)
Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pubmed/28756915
42
LRVQWRNNST-cell epitopesHeV G475
Nipah virus (NiV) Nipah henipavirus (NeV)
Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pubmed/28756915
43
FRRNNAIAFT-cell epitopesNiV M196
Nipah virus (NiV) Nipah henipavirus (NeV)
Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pubmed/28756915
44
LEFRRNNAIT-cell epitopesNiV M194
Nipah virus (NiV) Nipah henipavirus (NeV)
Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pubmed/28756915
45
FRRNNAIAFT-cell epitopesHeV M196
Nipah virus (NiV) Nipah henipavirus (NeV)
Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pubmed/28756915
46
LEFRRNNAIT-cell epitopesHeV M194
Nipah virus (NiV) Nipah henipavirus (NeV)
Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pubmed/28756915
47
VPATNSPELMHC class I binding peptidesNucleocapsid38Nipah virus (NiV)Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4624138/
48
SLLNLRSRLMHC class I binding peptidesNucleocapsid474Nipah virus (NiV)Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4624138/
49
EPYGAAVQLMHC class I binding peptidesPhosphoprotein624Nipah virus (NiV)Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4624138/
50
NPADDNDSLMHC class I binding peptidesPhosphoprotein464Nipah virus (NiV)Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4624138/
51
IAFNLLVYLMHC class I binding peptidesMatrix201Nipah virus (NiV)Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4624138/
52
FQKNLCFSLMHC class I binding peptidesMatrix293Nipah virus (NiV)Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4624138/
53
LLFVFGPNLMHC class I binding peptidesFusion209Nipah virus (NiV)Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4624138/
54
KQTELSLDLMHC class I binding peptidesFusion192Nipah virus (NiV)Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4624138/
55
AQITAGVALMHC class I binding peptidesFusion125Nipah virus (NiV)Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4624138/
56
RIIGVGEVLMHC class I binding peptidesGlycoprotein247Nipah virus (NiV)Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4624138/
57
EGLLDSKILMHC class I binding peptidesGlycoprotein38Nipah virus (NiV)Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4624138/
58
ILSAFNTVIMHC class I binding peptidesGlycoprotein45Nipah virus (NiV)Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4624138/
59
NPQEKICVLMHC class I binding peptidesL protein1688Nipah virus (NiV)Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4624138/
60
FPLWSTEELMHC class I binding peptidesL protein1482Nipah virus (NiV)Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4624138/
61
DGDVERRNLMHC class I binding peptidesW protein66Nipah virus (NiV)Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4624138/
62
NPTAVPFTLMHC class I binding peptidesV protein186Nipah virus (NiV)Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4624138/
63
DGDVERRNLMHC class I binding peptidesV protein66Nipah virus (NiV)Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4624138/
64
KEEPPQKRLMHC class I binding peptidesV protein316Nipah virus (NiV)Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4624138/
65
PDMDLLQALMHC class I binding peptidesC protein116Nipah virus (NiV)Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4624138/
66
MMASILLTLMHC class I binding peptidesC protein0Nipah virus (NiV)Homo sapiensresearch papermd.afzal294@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4624138/
67
EGIAIGPPVMHC class I allelesFusion protein441449Nipah virusHomo sapiens
HLA C∗1203, HLA C∗0303, HLA A∗6802, HLA C∗1402, HLA A∗0206
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
68
EWISIVPNFMHC class I allelesFusion protein307315Nipah virusHomo sapiens
HLA C∗0303, HLA C∗1203, HLA C∗1402, HLA A∗2301, HLA C∗0702
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
69
FILVRNTLIMHC class I allelesFusion protein315323Nipah virusHomo sapiens
HLA C∗0303, HLA C∗1203, HLA C∗0701, HLA A∗0206, HLA A∗0201, HLA C∗0602
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
70
IIVRVYFPMHC class I allelesFusion protein276284Nipah virusHomo sapiens
HLA C∗1203, HLA C∗0303, HLA A∗0206, HLA A∗6802, HLA A∗0201
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
71
ISIVPNFILMHC class I allelesFusion protein309317Nipah virusHomo sapiens
HLA C∗0303, HLA B∗1502, HLA C∗1203, HLA B∗5801, HLA C∗1502
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
72
LLDTVNPSLMHC class I allelesFusion protein480488Nipah virusHomo sapiens
HLA C∗0501, HLA C∗1203, HLA A∗0201, HLA C∗1402, HLA B∗1502, HLA A∗0206
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
73
TVNPSLISMMHC class I allelesFusion protein483491Nipah virusHomo sapiens
HLA C∗1203, HLA C∗0501, HLA C∗0303, HLA B∗3501, HLA C∗0702, HLA C∗1402, HLA B∗1502, HLA C∗0701
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
74
VGILHYEKLMHC class I allelesFusion protein2533Nipah virusHomo sapiens
HLA C∗0303, HLA C∗1203, HLA B∗1502, HLA C∗0702, HLA C∗1402
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
75
VYFPILTEIMHC class I allelesFusion protein280288Nipah virusHomo sapiens
HLA C∗1402, HLA C∗1203, HLA A∗2301, HLA C∗0303, HLA C∗0602, HLA C∗0702, HLA C∗0701
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
76
AQITAGVALMHC class I allelesFusion protein126134Nipah virusHomo sapiens
HLA C∗0303, HLA B∗3901, HLA A∗0206, HLA B∗1501, HLA B∗1502, HLA C∗1203, HLA B∗4001
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
77
EGIAIGPPVMHC class I allelesFusion protein441449Nipah virusHomo sapiens
HLA C∗1203, HLA C∗0303, HLA A∗6802, HLA C∗1402, HLA A∗0206
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
78
IGFCLITKRMHC class I allelesFusion protein328336Nipah virusHomo sapiens
HLA C∗0303, HLA C∗1203, HLA A∗3101, HLA A∗6801, HLA C∗1402
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
79
ISFIIVEKKMHC class I allelesFusion protein513521Nipah virusHomo sapiens
HLA C∗1203, HLA A∗6801, HLA A∗1101, HLA C∗1502, HLA C∗0303, HLA C∗1402
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
80
ISMLSMIILMHC class I allelesFusion protein489497Nipah virusHomo sapiens
HLA B∗1502, HLA C∗1203, HLA C∗1402, HLA C∗0303, HLA C∗1502
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
81
ITFISFIIVMHC class I allelesFusion protein510518Nipah virusHomo sapiens
HLA C∗1203, HLA A∗6802, HLA A∗0206, HLA C∗1402, HLA A∗3001
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
82
LSLDLALSKMHC class I allelesFusion protein197205Nipah virusHomo sapiens
HLA C∗1502, HLA A∗3001, HLA A∗1101, HLA C∗1203, HLA C∗0303, HLA C∗1402
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
83
ILTEIQQAYMHC class I allelesFusion protein284292Nipah virusHomo sapiens
HLA C∗1502, HLA C∗1203, HLA A∗1101, HLA C∗0303, HLA C∗1402, HLA A∗3001
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
84
MLSMIILYVMHC class I allelesFusion protein491499Nipah virusHomo sapiens
HLA-A∗02:01, HLA-A∗02:06, HLA-A∗68:02, HLAC∗12:03, HLA-C∗14:02
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
85
NTYSRLEDRMHC class I allelesFusion protein523531Nipah virusHomo sapiens
HLA A∗6801, HLA C∗0303, HLA C∗1203, HLA C∗1402, HLA C∗0701, HLA C∗1502, HLA A∗3101
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
86
PTSSGDLYYMHC class I allelesFusion protein535543Nipah virusHomo sapiens
HLA A∗2902, HLA C∗1203, HLA C∗0303, HLA A∗0101, HLA B∗1502, HLA C∗1402, HLA C∗0501
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
87
TAAQITAGVMHC class I allelesFusion protein124132Nipah virusHomo sapiens
HLA A∗6802, HLA C∗1203, HLA C∗0303, HLA C∗0501, HLA C∗1502
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
88
TELSLDLALMHC class I allelesFusion protein195203Nipah virusHomo sapiens
HLA C∗0303, HLA B∗1502, HLA B∗4001, HLA B∗4002, HLA C∗1203, HLA B∗3901, HLA C∗0702
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
89
VRPTSSGDLMHC class I allelesFusion protein533541Nipah virusHomo sapiens
HLA B∗1502, HLA C∗0602, HLA C∗1402, HLA C∗1203, HLA C∗0701, HLA C∗0702
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
90
YEKLSKIGLMHC class I allelesFusion protein3038Nipah virusHomo sapiens
HLA B∗1502, HLA C∗1203, HLA C∗0303, HLA B∗4001, HLA B∗4002
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
91
YIKEAQRLLMHC class I allelesFusion protein473481Nipah virusHomo sapiens
HLA C∗1203, HLA B∗1502, HLA C∗0701, HLA C∗0602, HLA C∗0303, HLA C∗0702
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
92
YYIIVRVYFMHC class I allelesFusion protein274282Nipah virusHomo sapiens
HLA A∗2301, HLA C∗1402, HLA A∗2402, HLA C∗0702, HLA C∗1203, HLA C∗0303, HLA B∗1502
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
93
FIEISDQRLMHC class I allelesGlycoprotein428Nipah virusHomo sapiens
HLA B∗1502, HLA C∗0303, HLA C∗1203, HLA C∗0501, HLA C∗0702, HLA C∗1502
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
94
FPAVGFLVRMHC class I allelesGlycoprotein364372Nipah virusHomo sapiens
HLA C∗0303, HLA C∗1203, HLA A∗6801, HLA B∗1502, HLA B∗3501
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
95
ISCPNPLPFMHC class I allelesGlycoprotein164172Nipah virusHomo sapiens
HLA C∗0303, HLA B∗5801, HLA C∗1203, HLA B∗1501, HLA B∗1502, HLA C∗1402, HLA C∗1502, HLA B∗3501
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
96
ITIPANIGLMHC class I allelesGlycoprotein118126Nipah virusHomo sapiens
HLA C∗0303, HLA C∗1203, HLA A∗6802, HLA B∗1502, HLA A∗0206, HLA C∗1502, HLA C∗1402
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
97
TEIGPKVSLMHC class I allelesGlycoprotein103111Nipah virusHomo sapiens
HLA C∗0303, HLA B∗4001, HLA C∗1203, HLA B∗1502, HLA B∗4002, HLA B∗3901
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
98
TLYFPAVGFMHC class I allelesGlycoprotein361369Nipah virusHomo sapiens
HLA C∗0303, HLA C∗1402, HLA B∗1502, HLA C∗1203, HLA A∗3201
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
99
VFYQASFSWMHC class I allelesGlycoprotein452460Nipah virusHomo sapiens
HLA C∗1203, HLA C∗1402, HLA C∗0303, HLA B∗5801,HLA A∗2301
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
100
VGFLVRTEFMHC class I allelesGlycoprotein367375Nipah virusHomo sapiens
HLA C∗1203, HLA C∗0702, HLA C∗1402, HLA B∗1502, HLA C∗0303
Computational
Research paper
vibhishagsbtm@gmail.com
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4131549
Loading...
 
 
 
WorkingSheet
 
 
Main menu