1 of 261

Please put the Individual Final Project ideas after the slide of your node. Thanks.

2 of 261

3 of 261

More BioClub Logos. Feel free to use them on your slide.

4 of 261

BIOSCRIBE: Redefining Ink

Aim- To revolutionize sustainable design by creating self-replenishing, biologically powered ink pens, enabling continuous color production through biological processes, merging synthetic biology with practical, everyday applications in creative tools. It will help in reducing waste and reliance on synthetic chemicals, while paving the way for eco-friendly, living technologies in everyday products.

Genetically engineered bacteria can produce natural fluorescent ink. These bacteria grow and make pigments, so the pen can keep “recharging” itself.

Today’s pens use chemical inks that eventually dry up and get thrown away. This creates waste, pollution, and need for replacements.

What if we could replace that with a sustainable, self-renewing source of ink? This shows how synthetic biology can bring innovation even to simple things like stationery.

Overview- I will first design and edit DNA sequences of green fluorescent proteins aka GFP. These constructs will be inserted into E.coli via expression vector pGLO, forming genetic circuits that regulate pigment production. I’ll simulate this workflow computationally and explore protein design for unique color shades. If scaled for real-world use, bioproduction and cell-free systems could allow refillable cartridges.

By- Aprajita Shukla

To create a self-replenishing fluorescent pen using engineered bacteria.

5 of 261

Gene Selection and Codon Optimisation

Cloning into Vector

Transformation and Selection

Expression and Cultivation

Cartridge Loading

Fluorescent ink

Chatgpt 4.0 generated

6 of 261

FUTURE OF BIOSCRIBE AND BACTERIAL FLUORESCENCE

Systems like Raspberry pi can be used to log detection of toxins using fluorescence

Replacing traditional ink for sustainable stationery, Printer ink alternative (3D printing can form living structures)

Chatgpt 4.0 generated

Biodegradable display screens for bio-labs, eco-sensitive designs

7 of 261

Hansen Jonathan

AIMS

🧪 "Restoring marine sediments will have a direct and positive impact on mercury pollution,"� – Dr. Andrea G. Bravo, MER-CLUB

🌊 Meanwhile, microplastics sink and settle silently in ocean sediments (Clark et al., 2016).

Xue, Y., Du, P., Ibrahim Shendi, A. A., & Yu, B. (2022). Mercury bioremediation in aquatic environment by genetically modified bacteria with self-controlled biosecurity circuit. Journal of Cleaner Production, 337, 130524. https://doi.org/10.1016/J.JCLEPRO.2022.130524

Clark, J. R., Cole, M., Lindeque, P. K., Fileman, E., Blackford, J., Lewis, C., ... & Galloway, T. S. (2016). Marine microplastic debris: a targeted plan for understanding and quantifying interactions with marine life. Frontiers in Ecology and the Environment, 14(6), 317-324.

Directorate-General for Environment. (2024, November 13). Paving the way to mercury clean-up with marine bacteria - European Commission. https://environment.ec.europa.eu/news/paving-way-mercury-clean-marine-bacteria-2024-11-13_en

https://honorable-beryl-e1b.notion.site/Hansen-s-HTGAA-Journey-198944042f0e805c96aedb60a622130b?pvs=4

By Hansen Jonathan

Genetically Modified E. coli BL21 for Mercury and Microplastic Bioremediation with Biocontainment Contingency

1. Build Genetic Circuit for Mercury & Microplastic Bioremediation with E. coli BL21

2. Build Genetic Circuit for Biocontainment Effect with E. coli BL21

8 of 261

Hansen Jonathan

By Hansen Jonathan

Genetically Modified E. coli BL21 for Mercury and Microplastic Bioremediation with Biocontainment Contingency

Genetic Circuit as Proof of concept and upstream part of the research

9 of 261

Genetically Modified E. coli BL21 for Mercury and Microplastic Bioremediation with Biocontainment Contingency

Hansen Jonathan

Genetic Circuit as Proof of concept and upstream part of the research

-Made from strong and popular parts in iGEM and main journal reference

-Must be proven with wet lab experiments

10 of 261

Yash Sawant, Bioclub Tokyo, Mumbai, India

Synthetic Biology-Based Wearable Patch for Non-Invasive Volatile Organic Compound Detection in Diabetes Mellitus

Problem: �Diabetic patients emit Volatile Organic Compounds like acetone through the skin, but current monitoring relies on invasive glucose tests.

Solution:�A wearable, cell-free synthetic biology patch detects acetone from sweat and gives a fluorescence output — enabling non-invasive, real-time monitoring.

11 of 261

Yash Sawant, Bioclub Tokyo, Mumbai, India

Aim 1: Build the Sensing Circuit

2. Visualized the acetone-aptamer to �analyze binding sites and predict �conformational changes.

3. Integrated the acetone-binding aptamer �into a synthetic riboswitch model for� gene expression control.

1.Docking acetone with potential aptamers to predict binding affinityLigand used : Acetone�SMILES: CC(C)=O��Target Protein: 1ehz.pdb - Yeast phenylalanine tRNA, A known RNA aptamer structure (used as a model for the synthetic riboswitch)��Outcome:�Acetone binds within a plausible pocket on the aptamer model, supporting its use in riboswitch design.�The availability of several conformations with equivalent energies lends credence to the concept that the aptamer can bind acetone selectively, potentially triggering a conformational change required for riboswitch activation. (Experimental validation is pending)

− Acetone: Aptamer folded, RBS hidden → Translation OFF

+ Acetone: Aptamer unfolds, RBS exposed → Translation ON

TTTGTAGAGTCTTAA

Aptamer� sequence

12 of 261

Yash Sawant, Bioclub Tokyo, Mumbai, India

Aim 2: To experimentally confirm binding affinity of acetone and if the binding induces the predicted conformational change/ To overcome the limitations

Minimum free energy decreases from -276.40 kcal/mol to -253.61 kcal/mol in the presence of acetone, indicating that the structure becomes less stable. �high ensemble diversity indicates that the RNA is taking on numerous conformations, in the presence of Acetone�Validation of the binding affinity and conformation changes of Acetone-Aptamer experimentally using spectroscopic methods is needed.�There is an increase in acetone in diabetic sweat but it is still relatively less than breath, higher sensitivity has to be established

With Acetone

Without Acetone

Aim 3: To create a real-time, portable biosensing patch for non-invasive diabetes monitoring by coupling with Smartphone interface

Objectives and future prospects

(When acetone binds, local entropy peaks show areas with more structural flexibility, like the aptamer, while other areas stay stable)

1.Non-invasive & passive unlike breathe based

2. Programmable detection compared to traditional glucose detectors due to Syn-Bio

VOC profiles can indicate a spectrum of conditions not just Diabetes

3.Eventual integration into a smartphone interface for real time monitoring

13 of 261

14 of 261

Ischemia-Reperfusion (I/R) Injury and Mitochondria

I/R Injury: Blood supply restoration after ischemia can worsen damage instead of aiding recovery [1].

Calcium Overload & mPTP Opening: Reperfusion causes calcium influx, opening mPTP, disrupting membrane potential, stopping ATP synthesis, and triggering cell death [1].

Problem

CypD-Targeting Peptide for mPTP Inhibition in Ischemia-Reperfusion Injury

Active CypD

inActive CypD

1

Alireza Hekmati, Bio Club, Bujnord, Iran, AlirezaHekmati80@gmail.com

15 of 261

Problem

CypD-Targeting Peptide for mPTP Inhibition in Ischemia-Reperfusion Injury

Active CypD

inActive CypD

1

Alireza Hekmati, Bio Club, Bujnord, Iran, AlirezaHekmati80@gmail.com

I/R Injury

16 of 261

Problem

CypD-Targeting Peptide for mPTP Inhibition in Ischemia-Reperfusion Injury

Active CypD

inActive CypD

1

Alireza Hekmati, Bio Club, Bujnord, Iran, AlirezaHekmati80@gmail.com

Ischemia-Reperfusion (I/R) Injury and Mitochondria

I/R Injury: Blood supply restoration after ischemia can worsen damage instead of aiding recovery [1].

17 of 261

Alireza Hekmati, Bio Club, Bujnord, Iran, AlirezaHekmati80@gmail.com

Protocol

CypD target sequence in red and yellow in pymol

Benchling Plasmid

Peptide Binder to Red sequence

(Designed by AfDesign)

plddt 0.81 ptm 0.76 i_ptm 0.84

SSQEPSKQSMSKKSSPAGNGQAGQVNNPDASKRETSKSSHFENPASSCTHQETHWEFCERMKKYYEKERF

E. Coli Expression

Evaluation

Assay readout

Cell + peptide

Stress

2

18 of 261

Outcome

Each 30-minute delay in reperfusion therapy is associated with a 7.5% relative increase in 1-year mortality for patients [4]

During liver transplantation, I/R injury is a significant cause of graft dysfunction and failure. [3]

For more details visit my notion page

1. In silico

2. In vitro

3. In vivo

4.Clinical trials

“reperfusion alone can contribute up to 30% to 40% of total infarct size following coronary artery occlusion.” [5]

Ischemia-reperfusion (I/R) injury remains a critical challenge in myocardial infarction (MI) treatment, but no FDA-approved drugs specifically target this mechanism in current clinical protocols. [7]

Alireza Hekmati, Bio Club, Bujnord, Iran, AlirezaHekmati80@gmail.com

3

19 of 261

Other assays

Mitochondrial Swelling Assay

Mitochondrial Membrane Potential (ΔΨm) Measurement

mPTP Opening Assay (Calcein-AM/CoCl₂ Method)

Groups

Control 1 no treatment

Control 2 Cyclosporin A

Experiment Top design.

Measure

Aims

1 Design Computationally

2 Execute in the lab

3 Approved as treatment

Alireza Hekmati, Bio Club, Bujnord, Iran, AlirezaHekmati80@gmail.com

20 of 261

Lignin-Degrading Enzymes for Biomass Valorization

Azmine Toushik Wasi, Sylhet, Bangladesh (azminetoushik.wasi@gmail.com) | BioClub Tokyo, Japan

Motivation: Lignin, a complex and recalcitrant polymer, limits the efficient conversion of biomass into valuable biofuels and chemicals. This is because its rigid structure and chemical composition make it highly resistant to enzymatic degradation, hindering the overall efficiency of biomass conversion processes.

Background Research

ML Models

In-silico

Validation

Research, identify, and enerate enzyme scaffolds based on natural lignin-degrading enzymes using diffusion models.

Goal: Mimic natural enzyme structure while optimizing for efficiency.

Refine the generated enzyme scaffold sequences using ProteinMPNN/ other models.

Goal: Design robust, stable, and efficient enzyme sequences.

Perform enzyme-substrate docking and molecular dynamics simulations to validate performance.

Goal: Predict enzyme-substrate binding and catalytic efficiency.

Next Steps: Mass production of these lignin-degrading enzymes can be achieved by expressing them in high-yield microbial hosts like E. coli or Pichia pastoris using fermentation bioreactors. Optimized upstream (growth conditions, media composition) and downstream (purification, stabilization) processes ensure high enzyme yield and stability. Enzyme immobilization or formulation into enzyme cocktails can further enhance efficiency for large-scale industrial applications.

What’s’ next?

21 of 261

Farhani Syafwani ( farhanisyafwani@gmail.com )

Biodegradable Bioengineered Fiber for Sustainable Apparel

The fashion industry relies on fibers like polyester and nylon, which contribute to microplastic pollution and environmental degradation. There is a need for a sustainable alternative that combines the benefits of synthetic and natural fibers while remaining biodegradable.

Idea: Develop a synthetic natural fiber that is biodegradable and suitable for clothing.

Objective: To engineer biodegradable fiber hybrids suitable for clothing by integrating bacterial nanocellulose (BNC) with natural fibers, enhancing both environmental sustainability and material performance.

Engineer Komagataeibacter to enhance bacterial nanocellulose (BNC) production

22 of 261

BioClub Tokyo

Farhani Syafwani ( farhanisyafwani@gmail.com )

23 of 261

Farhani Syafwani ( farhanisyafwani@gmail.com )

24 of 261

Engineering Microbial Cell Factories for Sustainable Drug Production

Background:

  • Marine sponges produce unique bioactive compounds with medical applications (Proven by various studies and existing drugs).
  • Harvesting from sponges is unsustainable and inefficient.

Solution:

  • Use genetically engineered yeast to produce these compounds.
  • Mimics biosynthetic pathways of marine sponges.
  • Creates a scalable, eco-friendly production platform.

Chairunnisa Amanda, BioClub Tokyo, Jakarta, Indonesia (amandadermawan1@gmail.com)

Scalable Production of Marine Natural Products Using Genetically Engineered Yeast

Successful Example ->Artemisinin: An anti-malarial drug produced using engineered yeast

25 of 261

Aims

Aim 1: Computational Discovery of Biosynthetic Pathways

To identify a therapeutically relevant bioactive compound from a marine sponge and use available genomic and transcriptomic data to predict and analyse the biosynthetic gene clusters (BGCs) responsible for its production.

Aim 2: In Silico Design and Simulation of Synthetic Pathway

To design synthetic gene constructs optimized for yeast expression, simulate their integration into the host metabolism using computational tools, and develop a DNA assembly plan.

Bisucaberin B

26 of 261

Aims

Aim 3: Visionary – Towards Scalable Microbial Factories

To envision and outline the development of a scalable and sustainable microbial platform capable of producing sponge-derived natural products through genetically engineered yeast, ultimately replacing environmentally harmful harvesting practices and enabling broader applications in drug discovery.

A photochemical process developed by Sanofi and now operated by Huvepharma in Garessio, Italy, can produce 370-kg batches of semi-synthetic artemisinin.

27 of 261

28 of 261

Xinyao Ma, Beijing, China; BioClub Tokyo

DNA origami-based drug delivery

3D DNA origami containers & insulin (or other regulatory hormones/drugs) for timely delivery: in tandem with diagnostics + signal transduction, which makes origami scaffolds secrete synthesized hormone/drug.

*revision for insulin-origami idea: produce coagulants/anti-coagulants and release based on need. Thus we need a platform to detect blood clots AND we need locomotion

possible synthesis target: heparin?

the whole process would run like this: figure out origami & controlled release -> engineer bacteria producing target molecule and DNA origami -> figure out monitoring mechanism (platform) & locomotion (if needed) -> integrate suicide switch (for safety)

proof of concept include: origami secretion from chassis, controlled release from origami, origami durability, origami uncontrolled release risk

29 of 261

Xinyao Ma, BioClub Tokyo

Parkinson early diagnosis by detecting perillaldehyde (biomarker). By engineering a novel protein receptor.

protein LLM?tokenization & analysis of other non-biomolecule ligand binding proteins -> generate sequence -> use AlphaFold and PyMol dock for bioinfo analysis and screen for the best

*inspiration: iGEM 2024 Plasmid.AI

A Modular Metabolic Engineering Simulator for Biochemical Production Estimation

Cybergenetics, Machine Learning, Synthetic Biology, Bioengineering

Model

parameters data for training: part registry, BiGG Models, KEGG, MetaCyc; complexity -> computational load (algorithm effectiveness); scope (E.coli & S.cerevisiae?)

key components:

basis: genetic circuit modeling

literature review: Cello, iBioSim, OptFlux, COBRA, other models

methods: ODEs, COBRApy, RAVEN (matlab), kinetic models

integration

key principles: modularity (for genetic circuit parts),

validation: use studies

User Interface

graphical user interface with Python

Functions: input parameters, select genetic parts, choose metabolic pathways & chassis, visualize results

30 of 261

Nipada Srisereenuwat, Nakhon Ratchasima, Thailand, BioClub Tokyo

No Turning vs. Turning method

Problem (Why?)

  • It takes a lot of effort to turn those compost pile every week.
  • Land owner who wants to grow new plants, can’t wait for 6 months to get a quality compost.

https://images.app.goo.gl/PWGEfbqMReue8NbE9

How can we reduce composting time and effort through biological engineering tool?

Compost Accelerator for No-Turn Compost method

Turn leaves into compost

Aim 1: To develop accessible tool kit that allow people to engineer bacteria that can help make their compost faster

Aim 2: To increase number of people that make their own compost and reduce health problems from chemical fertilizer

Aim 3: To reduce fire hazard in forest property

Turning Method

No-Turn method

Time

3-6 months (faster with consistent turning)

6-18 months (slower due to limited oxygen)

Effort

Requires physical labor to turn the pile regularly.

Minimal physical effort required after initial pile setup.

Stakeholder: Land owner who wants to make their own quality compost

Solution: make cellulase enzymes able to break down a lot of cellulose (leaves, wood) in a short amount of time

31 of 261

32 of 261

PostApoc-D

PostApoc-D

Genetically Engineered Yeast to feed the world

Plant Waste (Cellulose) Food (Glucose)

Ergosterol Vitamin D2

S. cerevisiae engineered with UV-stable exoglucanase to generate glucose from cellulose. Treated with UV to produce Vit D producing a consumable

UV-B-radiation

Syed Tauheed Ahmad, BioClub Tokyo, Peshawar, Pakistan- tauheedsyed@hotmail.com

Designed instruction-set

Also contains:

33 of 261

Anushka Shinde, Bioclub Tokyo, Ahmedabad, India

HOW CAN I MAKE A ROOM TRULY A ‘LIVING ROOM’?

Can we collaborate with microorganism, and develop microorganism that may enable to grow ready-to-use products?

Slime molds grow in the direction of food supply. What if you can use that and design their path to create surface patterns, or industrially called CMF (colour, Material, Finish)?�Is this the CMF of future?

The Japan metro network is the best example of slime mold intelligence. �What other products may be generated in a similar way?�What materials will be used for this?�How does a future with products with a similar ideology look like?�Is it possible to manufacture or localize it?�Will synthetic microbes/plants/organisms be developed for this?

34 of 261

Anushka Shinde, Bioclub Tokyo, Ahmedabad, India

WHAT

WHY

HOW

WHERE

WHEN

Developing ‘living products’ using microbes/plants/materials that respond and evolve as per stimuli

This project is an enquiry on the future of materials and the shift in Human Centered Interaction which might occur due to the shift

Developing Biomaterials, wetlab work, (maybe) some SynBio, Biofabrication

Ahmedabad, India, National Institute of Design

Beginning now!

Meeting review: No literature on engineering slime mold yet. But bacteria/microbes can be engineered that may interact with the slime mold and determine its growth

35 of 261

Supanat Deawrattanakun, Bangkok, Thailand

Bioclub, Tokyo

design genetic circuit in benchling to detect serotonin then produce GFP

Aim 1 1

Synthetic Genetic Circuit for Serotonin Detection

Aim 3

Aim 2

  • synthesis designed genetic circuit
  • expand it to more complicated function, e.g. can detect many different hormones and show different colors

Add more human’s emotion aspect in Human-Computer Interaction

36 of 261

The First Gene Circuit on Earth

Md Rasel Uddin, Jashore, Bangladesh

Then came the early organism with membrane and genetic material. Capable to reproduce.

First came the self-replicating molecules.

Then the hypothetical organism, Magna superstes (Great Survivor) came. It had two genes: gene A and gene B.

In tough conditions, gene A expresses and halts the reproduction.

In good or favourable conditions, gene B expresses which represses gene A, therefore reproduction continues.

Gene B became more special. Achieved a mutation that gave it DNA repair capability.

In bad situations, DNA breaks. So gene B goes busy repairing the DNA and not involved in repressing the gene A anymore. So, gene A expresses and gene A halts cell reproduction until the DNA is repaired.

These are all hypothetical and also stolen from David Sinclair’s book ‘Lifespan’.

If it is hypothetical and also Sinclair’s idea, then what is my input? I want to synthesize the circuit and I want to create the Magna superstes, in-silico and in-vivo.

Email: raseluddin.synbio@gmail.com

37 of 261

BioClub Tokyo, Japan

Malika Tulenbergenova

Astana, Kazakhstan

malika.tulenbergenova@nu.edu.kz

Plastic pollution is a growing environmental problem. Most biodegradable plastics depend on petroleum based or crop-derived sources, which makes them unsustainable

A possible solution for this could be: Engineer halophilic archaea (e.g., Halobacterium salinarum) to produce PHA/PLA;

It’s a scalable, low-resource system.

*PHA - polyhydroxyalkanoates, polyesters produced by some organisms naturally, through processes like bacterial fermentation etc

38 of 261

BioClub Tokyo, Japan

Malika Tulenbergenova

Astana, Kazakhstan

malika.tulenbergenova@nu.edu.kz

As most PHA producing bacteria require strict pH, oxygen and temperature control, archaea can be an alternative, as i ist more resistant to conditions’ fluctuations.

Why Archaea?

  • extreme tolerance: it can thrive in high salinity environments, reducing contaminaitno risks;
  • natural PHA producer: some species naturally produce PHAs, ideal for bioplastic production
  • waste utilization: can be engineered to use industrial waste as feedstock, => making production cost effective

https://microbiologysociety.org/publication/past-issues/archaea/article/archaea-and-crispr-biology.html

39 of 261

BioClub Tokyo, Japan

Malika Tulenbergenova

Astana, Kazakhstan

malika.tulenbergenova@nu.edu.kz

Experimental Design &Methodology

Methodology:

1. Gene Selection & Modification:

  • identify and modify PHA biosynthesis genes using CRISPR.

2. Strain Engineering & Growth Optimization:

  • introduce modified genes into archaea and optimize conditions for maximum yield.

3. Waste Utilization Testing:

  • grow engineered archaea on industrial and agricultural waste and measure PHA production.

4. PHA Extraction & Analysis:

  • extract, characterize, and compare biodegradability with commercial bioplastics.

40 of 261

BioClub Tokyo, Japan

Malika Tulenbergenova

Astana, Kazakhstan

malika.tulenbergenova@nu.edu.kz

Challenges

1. CRISPR in Archaea: Fewer genetic tools than in bacterial systems;

And overall compared to bacteria, there are much fewer established genetic tools and protocols for CRISPR modification in archaea. => we have to explore the protocols (e.g., suitable conditions first)

2. PHA Yield: Possibly lower efficiency than bacterial production;

Despite that using archaea is more cost effective, the efficiency might be lower, because their cell structure (such as ether linked membrane lipids) & adaptation to extreme environments may limit nutrient uptake => lowering the PHA yields

3. Limited knowledge of Archaea: archaeas are less studied compared to bacteria;

There are some gaps in understand their genetics and metabolism

https://biologydirect.biomedcentral.com/articles/10.1186/s13062-020-00262-7

41 of 261

BioClub Tokyo, Japan

Malika Tulenbergenova

Astana, Kazakhstan

malika.tulenbergenova@nu.edu.kz

Challenges

Regarding the PHA Yield more detailed,

As it can be seen from the picture, unlike bacteria bacteria, which have ester - linked membrane lipids, archaea possess ether -linked lipids/

These bonds, in turn, give greater stability and resistance to extreme conditions => results in reduced membrane fluidity and permeability

=> the rigidity can limit the transport of nutrients and metabolic intermediates across the membrane => potentially slowing down teg growth rates => reducing efficiency of metabolic processes like PHA synthesis

https://biologydirect.biomedcentral.com/articles/10.1186/s13062-020-00262-7

42 of 261

How far the mutant could change from the original

Anandita Amalia, Yogyakarta, Indonesia

During lectures and recitations, I learned a ton of bioinformatic tools and some concept about protein. Awesome!

I also learned about mutation in sequence that contribute in stability, specific function, and overall structure. Then, I just wondering how far the mutant could change from the original. Thus, in this final project, I would examine basic concept about mutation by using bioinformatic tools.

Try to mutate protein sequence by using Protein MPNN, ESM

Compare one candidate to the others using AlphaFold Multimer

Choose the ideal one and compare to the original in several parameter

Parameter for the comparison: sequence, protein structure, protein stability, and protein binding site

43 of 261

Brendah Namugamba, Bio Club Tokyo, Kampala , Uganda brendanamugamba30@gmail.com

Carbon-Negative tryptophan production using engineered Cyanobacteria

Objective

To engineer cyanobacteria

(Synechococcus

elongatus)

to convert atmospheric

carbon dioxide into

tryptophan

using a synthetic pathway.

44 of 261

Immune Regulation of Transplanted Organs Locally

Designing a local immune suppression system inspired by fetomaternal interface

Problem: Organ transplants need long immunosuppressive therapies to prevent rejections and current therapies have many side effects which can cause mortality & morbidity on the long run.

Solution: Engineering and implementing a local immunosuppressant system to the transplanted organ/tissue -as in human placenta- may prevent both organ rejections and systemic side effects of the state of art therapies.

Aim 1: Designing & engineering a protein that can induce immunosuppressive state as in the case of uterine microenvironment in pregnancy.

Aim 2: Optimization of the gene expression and the protein stabilization

Aim 3: Evaluation of the designed protein stability, expression & functionality in silico firstly, then in vitro and in vivo if it looks promising.

Elif Dilan Gündüz, Giresun Turkey, elifdilangndz@gmail.com

DALL·E 2025-03-13 14.17.42

45 of 261

Andrés Frankow - Buenos Aires, Argentina.

frankow@gmail.com

Algae-Based Detoxification System for Glyphosate Degradation

Develop a genetically engineered alga, Chlamydomonas reinhardtii, capable of detoxifying glyphosate and its derivatives in freshwater environments. This system aims to reduce contamination levels and improve ecosystem health.

Key Components & Strategy:

  • Host Organism:� Chlamydomonas reinhardtii – a well-characterized model for algal biotechnology in freshwater.�
  • Genetic Construct:�
    • Plasmid Backbone: pChlamy_4 (or similar vector optimized for C. reinhardtii).
    • Promoter: pHSP70A-RBCS2 for strong, constitutive expression.
    • Detoxification Genes:
      • phnJ (encoding C-P lyase) to cleave the C-P bond in glyphosate.
      • Additional enzyme(s) to further degrade AMPA, ensuring complete detoxification.
    • Terminator: RBCS2 terminator for efficient transcription termination.
  • Expected Outcome:� A robust bioremediation system that significantly lowers glyphosate concentrations, contributing to cleaner freshwater and healthier aquatic ecosystems.

46 of 261

Yousif Graytee-Baghdad, Iraq

Targeting SETD8: Mechanisms, Inhibitor Development, and Therapeutic Potential

. SETD8 is a lysine methytrasnferase that monomethylates histone H4 at lysine 20

. Regulates chromatin compaction and transcriptional repression. Also controls cell cycle progression through interactions with p53. PCNA, and other proteins (methylates them)

.Protein is overexpressed in multiple cancers (ovarian, breast, prostate, etc..)

.Inhibitors have been identified and reported but they have limitations regarding potency, selectivity, and pharmacokinetic properties

.Goal is to identify novel SETD8 inhibitors and investigate their effects

.Screen drug-like molecules against SETD8’s catalytic domain and identify top candidates with strong binding affinity and specificity

47 of 261

Targeted Switchable Epigenome Editing

  • Methyl and acetyl transferases that turn genes on and off respectively
  • There are several classes of these - one being de novo transferases
  • Target specificity - TFs, CRISPR, Zinc finger motifs, TALEs

Drawbacks

  • dCas9 leads to mutagenesis since it forms R loops
  • Residual DNA cleavage activity
  • Genome organisation with histones - can have high plasticity in embryonic pluripotent cells (iPSCs?)
  • Duration of effects

Goals -

  • Primary - To develop a click chemistry or activable peptide based epigenome editing platform.

  • Secondary - To address the drawback of not being able to target high plasticity genomes
  • Tertiary - To make sure this system can easily be expanded to a one time treatment as shown

Rushda Parveen, Bhopal, India

Methyl/Acetyl transferase

48 of 261

49 of 261

BioClub Tokyo

50 of 261

{Ruchika Tekethotil, Pune, India} {Bioclub Tokyo Japan} {ruchikap2512@gmail.com}

BIOMINING POTENTIAL OF BACTERIAS TO RECYCLE COBALT FROM LITHIUM-ION BATTERIES

Objective: I aim to use geobacter’s resistance and nanoparticle coat formation from cobalt for biomining, via extraction of cobalt from spent lithium battery anodes

G. sulfurreducens exhibits a sophisticated, multi-faceted strategy for thriving in metal-rich environments. This includes metal sequestration, enhancing its growth in contaminated sites, and contributing to the sustainability of microbiomes dependent on cobamides. The bacterium’s ability to bio-mineralize cobalt offers new insights into microbial interactions with metals and the potential for biomining application.

51 of 261

Modulation of Microglial Activity by a synthetic protein

Abhilaya Makkuva, Hyderabad, Telangana

Bioclub Tokyo, Japan

Background: Microglia are resident immune cells of the brain, playing a key role in neuroinflammation and synaptic plasticity. In neurodegenerative disorders, microglial overactivation leads to excessive inflammation and neuronal damage.

Goal: To design a synthetic protein or modify an existing one that can bind to the microglia (microglial receptor) and either activate or suppress its signalling pathway leading to modulation of inflammation or phagocytosis

Step 1:

Through literature review, receptor selection, Protein design and structure prediction (alphafold)

Step 2:

Binding prediction and docking using autodock

Step 3:

Functional pathway analysis (still have to figure this out)

52 of 261

53 of 261

54 of 261

MaSp2 or major ampullate spidroin is a protein that make up spider dragline silk together with MaSp1. I select MaSp2 protein like what i choose in homework 1, because of its potential and promising physical properties that is superior. Therefore, it can be applicated to industrial, health, environment fields because of its biocompatible features (Yang et al., 2016). However, it is impossible to produce this protein from spider farming, so using synthetic biology we can integrate the genes and produce it in yeast or bacteria with fluorescent material for tissue engineering.

Hansen Jonathan

Kavya Sreekanth, Bengaluru, India

55 of 261

Kavya Sreekanth, Bengaluru, India

Kavya Sreekanth, Bengaluru, India

56 of 261

Dr. Data Cheuk Kwong NG, Hong Kong

Data@9lab.co

Modifying GFP as a biosensor to detect pet �(dogs or cats) ’s infection disease in their poop

Background:�Giardia intestinalis or Giardia lamblia, is a protozoan parasite that causes giardiasis, a common intestinal infection in dogs and cats. It is transmitted through the ingestion of cysts in contaminated water, food, or soil, and is a significant cause of diarrhea, weight loss, and malabsorption in pets Giardia in Pets.

Diagnosis typically involves fecal examination for cysts or trophozoites, antigen tests, or PCR-based methods.

Green Fluorescent Protein (GFP), originally isolated from the jellyfish Aequorea victoria, is a 27 kDa protein consisting of 238 amino acid residues that fluoresces green when excited by blue light.

Solution:

Using the modified GFP-tagged biosensor bind with antibodies to detect the Giardia ��- Target Antigens: Giardia cysteine proteases (CPs) are recognized as virulence factors and could serve as targets for GFP-tagged antibodies or peptides. Specifically, CP14019, CP16160, and CP16779 are key proteases involved in pathogenesis.�

- GFP Variants: Enhanced GFP (EGFP) (e.g. (U55762.1) with mutations F64L and S65T,

or split GFP could be used to create biosensors that bind specifically to these proteases or other Giardia antigens.

https://www.cdc.gov/giardia/about/index.html

Scope:

  • in silico / modeling
  • 3D Printing the test kit
  • Electronics for the UV illustration / detection

Similar Applications:

  • Parvovirus in Dogs
  • Feline Panleukopenia Virus
  • Campylobacter
  • Clostridium difficile
  • Cryptosporidium

Opportunities:

Most of the current solutions use PCR, culture, antigen kits. It takes days or very expensive to conduct the test for pets in vet.

57 of 261

58 of 261

59 of 261

60 of 261

Remediation system for heavy metal polluted water

Background

Arisa Tani, Bioclub Tokyo

Some plants, called hyperaccumulators can grow in contaminated soils and absorb the pollutants from the ground. A remediation technology using them is called phytoremediation. However, this method is not currently used because the plants grow too slowly, making it not very effective. I propose simulating the detoxification and accumulation processes of these plants in bacteria known to be safe to the human body to provide a temporary but quick and cost-effective method for drinking water remediation in contaminated areas.

Heavy metals, which are toxic to many organisms including humans, are released from volcanic activity or industrial plants leading to large-scale pollution of water sources. It is expensive and labor-intensive to clear these pollutants, and traditional methods can be harmful.

61 of 261

Living Memory: DNA-Based Digital Storage (In Silico)

Aryan Choudhary, Delhi, India: Bioclub Tokyo

Project Goal:� To design a secure, efficient method to encode digital data into synthetic DNA sequences, enabling long-term, high-density storage with potential biosecurity applications.

Core Concept – Encoding Digital Data into DNA:

  • Binary-to-Nucleotide Mapping:
    • Digital files are converted into binary (e.g., "HELLO" → ASCII → binary).
    • A 2-bit to 1-nucleotide encoding scheme is used:
      • 00 → A, 01 → C, 10 → G, 11 → T.

Additional Processing:

  • Can Compress and encrypt the data
  • Add Error correction to protect against mutations

62 of 261

Genspace

63 of 261

Chaotically bioprinted noodles

Claudia Alarcón López Claudia.alarconlpz@gmail.com

Tec de Monterrey

64 of 261

Butter Synthesis Using Yeast

Ideas: Turn off unnecessary metabolism

Engineer expression of different enzymes (through both genetic and epigenetic methods) to create the appropriate protein concentration

Aim: Focus on one enzyme in TAG synthesis in oleaginous yeast to make it more efficient

Explore ways of making the TAG profile in oleaginous yeast proportional to that of butter

Yehuda Binik, NYC, GenSpace, ybinik1@gmail.com

65 of 261

Idea 1:

Context:

Automation in synthetic biology is streamlining repetitive lab-processes and reducing error, however as makers and designers enter the space, the rigid frameworks make reduce scope for creativity and “happy accidents”

Hypothesis:

Embracing craft-like interactions within certain contexts of the lab will help designers and makers to engage with synthetic biology

Opportunity:

Hybrid digital tools in synbio that embody intuitive craft-like interactions

Gibson-Assembly Tsugite

(Gibson Assembly processes inspired by wood joinery)

William Eliot

Aim 1:

Make Gibson Assembly more intuitive through interaction design

Aim 2:

Create a framework for making other syn bio techniques more intuitive

66 of 261

Idea 2:

Context:

Mealworms are being researched for their ability to digest polystyrene, which tae up 30% of the volume of landfill. This is due to exiguobacterium in their gut which breaks downs plastics. However, using mealworms to digest polystyrene is impractical and poses ethical concerns.

Hypothesis:

Being able to replicate exiguobacterium outside of the mealworm will make polystyrene waste reduction possible at scale.

Opportunity:

Creating an incubator to cultivate exiguobacterium so that it can survive outside the mealworm

Exiguobacterium polystyrene digester

William Eliot

Aim 1:

Extract key proteins from exiguobacterium for analysis and edit them to make them stable outside of the mealworm

Aim 2:

Design a container for processing waste polystyrene using exiguobacterium

67 of 261

Messages to the future

  • I’ll be translating english -> DNA -> amino acids -> 3D protein simulations
    • Python scripts + ESMFold
  • My prompt for the english text: “what would you say to a society 100,000 years in the future?”
  • I’ll take the 3D protein simulation and make physical sculptures out of metal
    • May co-fold these with alphafold-multimer to see how a sentence or paragraph might look
  • I’ll also get the DNA sequences synthesized and embed them in the sculptures

(I will be doing the above for an art show in April)

  • Once I get started above, I’m sure I will have more expansive ideas for the final project
  • I’d like to try to insert the DNA into bacteria and explore what it would mean for these organisms to carry messages from humans
    • This would require practicing Gibson assembly and learning some more wet lab skills
    • Perhaps I will look at how those messages mutate over generations
  • I may also build a webapp to let others submit messages to the future and order a sculpture (or something more conceptual and not productized, tbd)

Nikhil Kumar, NYC, committed listener, Genspace

“Do we exist?”

“tat tvam asi”

68 of 261

Christina Cappelli

Genspace | Brooklyn, New York

E: christinacapp130@gmail.com

Food allergies, particularly to shellfish, can cause life-threatening reactions. This speculative concept aims to develop a rapid test. Using a lateral flow assay (LFA) designed to detect tropomyosin—a key allergenic protein in shellfish—within liquid food products such as sauces. Modeled after the design of a portable rapid test, the device would utilize antibodies that specifically bind to tropomyosin. The goal is to provide consumers and food professionals with an easy-to-use tool that enhances food safety and helps reduce the risk of allergic reactions by preventing their onset, rather than having to manage the reaction after it occurs.

69 of 261

Chien Lu, Jersey City, US | chien_lu@brown.edu | Week01 Notion Page

BACTERIAL-DRIVEN RESPONSIVE TEXTILES

(Smart Fabric with Living Materials / Bio-fiber Actuator)

  1. Find a nanoactuator that would react to (but not limited to) one of the following conditions:
    1. Light / Humidity / Temperature / Sound / Odor / Pressure / Vibration / Touch / Airflow / pH / Chemical Signals / Magnetic Fields / Electric Fields / Biological Signals / Biomass
  2. How might we use it in textile and potentially solve real-life problems?
  3. Potential applications:
    • Wearable
    • Vehicle Interior

*Projects I find interesting and inspiring are listed on the right, they’re linked in my W1 notion page as well.

70 of 261

Producing Ovalbumin with Yeast (Pichia Pastoris)

  • Summary: This project will engineer Pichia Pastoris to produce chicken ovalbumin, which represents 54% to 58% of the egg white protein by weight. To achieve this, a codon-optimized chicken ovalbumin gene will be integrated into the yeast expression vector pPIC9K, which has an alpha-factor secretion signal. This will enable the yeast to secrete the ovalbumin directly into the media to simplify downstream processing. In addition to the wet lab experiment, we will also use computational methods to map out the metabolic pathway of this engineered strain and use flux balance analysis to recommend changes to optimize titer.

Sohum Patnaik / Genspace / NYC / sohumpatnaik@gmail.com

71 of 261

David Chau, New York, USA / ddcc@alum.mit.edu

Build a computer using cells

For his thesis, Jai Padmakumar implemented the MD5 hash function with logic gates built from E. coli!

I’d like to do a simpler version of this.

I’d be pretty happy to get even a single logic gate working.

(I haven’t finished reading the thesis yet.)

72 of 261

David Chau, New York, USA / ddcc@alum.mit.edu

Silly Idea #2: A Food De-Spicer

I can’t handle spicy food:

Design a protein that binds or cleaves capsaicin to neutralize it :)

(Though not sure how to do it with tools we have since capsaicin is not a protein.)

73 of 261

Sustainable Production of Renewable Diesel Using Bioengineered Candida antarctica Lipase B

Problems:

  • Petroleum diesel is not sustainable and finite
  • Renewable diesel is produced via chemical hydrotreating which requires:
    • High T and P
    • Heavy metal catalysts that are expensive and difficult to dispose of
    • Energy-consuming production of hydrogens

Solution:

Bioengineer a lipase that can perform exact same reaction but:

  • Under mild conditions (room T and P)
  • No catalysts/cofactors required
  • Use wider range of feedstock
  • Cell free and thus simple biosecurity and biosafety protocols

Methods:

  • Literature search to analyse existing CALB mutants
  • In silico directed mutagenesis to increase CALB stability and catalytic efficiency
  • In silico screening of 3D structures and ligand interactions
  • Expression and extraction of mutated enzymes
  • Cell-free assays to test mutants functions and stability

Anastasia Bernaz, Abbotsford, Canada | Genspace | bernazstasy1902@gmail.com

Benefits:

  • More sustainable than traditional hydrotreating
  • Drop-in fuel requires no major changes in the existing infrastructure
  • Long-term economic stability

Candida antarctica

Renewable diesel

Project aims are in slide notes

74 of 261

Biosynthesis of indigo or phytomining

-interested in indigo since the industry dye process is a petroleum-based process that’s harmful to the environment

-biosynthesis of indigo for biosensing of heavy metals means genetically modifying E. coli to produce indigo when there are heavy metals present in the environment

-example: Neri Oxman’s PHA shoe dyed with bacterial induced indigo (2025)

Research Publications:

"Production of Indigo by Recombinant Bacteria" by Fabara et al. (2023)

https://pmc.ncbi.nlm.nih.gov/articles/PMC11308077/

-interested in soil health / remediation techniques. I’m learning about phytomining while reading Soil Not Oil by Vandana Shiva about moving towards regenerative agriculture

-phytomining is the process of extracting metals from soil through plants

Research Publications:

"Soil Phytomining: Recent Developments—A Review" by Kumpiene et al. (2024)

75 of 261

Sequestering Radioactive Waste Through Engineered Microbes

Approach:

  1. Transform E. coli with the plasmid using heat shock or electroporation.
  2. Grow on ampicillin plates to confirm transformation.
  3. Induce expression (if necessary) and check for protein production via SDS-PAGE or Western blot.
  4. Test Metal Binding – Expose cells to heavy metals (e.g., Cd²⁺, UO₂²⁺) and check for sequestration.

Heavy Metal Binding and Sequestration

  • MT binds heavy metal ions such as uranium (U), cesium (Cs), plutonium (Pu), strontium (Sr), and cadmium (Cd) via thiol (-SH) groups in cysteine residues.
  • Once bound, the metals are detoxified by being sequestered in the bacterial cytoplasm.

Application:

  • Engineer D. radiodurans with MT and introduce it into contaminated groundwater plumes near nuclear waste sites.
  • The bacteria bind and immobilize uranium (UO₂²⁺), plutonium, and strontium, preventing further contamination of drinking water sources.
  • How? The bacteria are either introduced directly or within a bioreactor system where water is pumped through biofilm-coated surfaces.

Elliot Waxman, New York, NY | Genspace | elliot.verified@gmail.com

76 of 261

Making Polymers with Agricultural Waste

Challenge: genetically modifying microorganisms to overexpress proteins that produce NADH and NADPH. These coenzymes are crucial for the biosynthesis of biodegradable materials, such as bioplastics. The focus will be on using Pseudomonas fluorescens_, _Bacillus megaterium_, and _Cupriavidus necator_ (formerly known as _Ralstonia eutropha_ or _Wautersia eutropha

Organisms:

  • Cupriavidus necator
  • Pseudomonas spp
  • Bacillus megaterium

Oscar Schrag - 03/11/25

77 of 261

Aim (25 words):

To design and implement a bio-screen art system using a repressilator-based genetic circuit that enables bio-pixels to oscillate between different visual patterns in a controlled manner.

Method (50 words):

Engineered bacterial cells containing a repressilator circuit are arranged in a grid to form bio-pixels. Fluorescent proteins, controlled by the circuit, oscillate in phases to create dynamic images. Environmental tuning (e.g., chemical inducers) modulates synchronization. Time-lapse fluorescence microscopy captures the transitions, generating a bio-art display cycling through predefined images.

Tanisha Shaw, NYC, USA

GENERATIVE BIO ART

78 of 261

Microbial Art - Khush

Aim (25 words):�To design living microbial art by patterning fluorescent E. coli on bacterial cellulose, creating a customizable biomaterial for future biofabrication applications.

Method (50 words):

  1. Grow Komagataeibacter xylinus to produce bacterial cellulose sheets or use agar sheets
  2. Sterilize cellulose, then pattern GFP-expressing E. coli using stencils or freehand techniques.
  3. Incubate to develop fluorescent designs.
  4. Optional: Enhance with glycerol (flexibility) or conductive polymers.
  5. Characterize material properties under UV/mechanical tests.

79 of 261

MoThief

Applications

- Abatement of Molybdenum from source and surface water, to discourage bacterial growth.

- Inhaled or Injected adjuvant therapeutic for various pulmonary bacterial infections (NTM & Pseudomonas aeruginosa) via reduction of bioavailable Molybdenum in sputum / lung tissue.

Background Info

- Molybdenum (& other trace metals) believed to play role in NTM & P. aeruginosa metabolisms.

- Source & surface water Mo levels greatest risk predictor for NTM infection in Cystic Fibrosis (CF) populations.

- Patients w/ pulmonary disease indications (CF & NCFB) have elevated sputum metal levels.

- Pulmonary NTM patients had significantly higher molybdenum blood serum concentrations (1.70 μg/L) compared to healthy controls (0.96 μg/L).

- Molybdenum sequestration (in-vivo or environmental) may improve NTM / other bacterial infection pathology or progression.

Project Overview

Step 1: Identify existing molybdenum-binding peptides and proteins to find workable template candidates and functional Motifs.

Step 2: Generate set of synthetic peptide sequences anticipated to have high affinity binding to Molybdenum via high-volume in-silico generation. Whittle down investigative candidate list based on overall predicted scoring metrics and predicted biocompatibility of candidate peptides (non-immunogenic + non-fouling + thermostable)

Step 3: Express and purify final candidate peptides for performance testing and application.

Step 4: Test candidate peptide performance via Molybdenum-bearing solution screening.

Step 5: Test final candidate peptide performance via in-vitro NTM / P. aeruginosa / sputum donor models, as well as in-vivo clinical trials in infected populations.

😭

Project Aims

Phase #1:

- In-silico design of peptide w/ high Molybdenum binding affinity, anticipated to be well-tolerated by human body.

Phase #2:

- Peptide synthesis + performance testing in Molybdenum-bearing solution.

- In-vitro testing of peptide performance in NTM / P. aeruginosa culture / sputum donor model.

Phase #3:

- Clinical testing of suite of metal abatement peptides (Mo, Zn, Cu, V, etc) in pulmonary NTM / Pseudomonas aeruginosa infected populations as adjuvant to antibiotic treatment.

Designed peptide which strongly binds to and sequesters Molybdenum (Mo), making it non-bioavailable to bacteria

Trevor Campbell, Cambridge, USA — tdcampnh@gmail.com

80 of 261

Nuke-a-Monas

Applications

- Inhaled therapeutic for treating pulmonary Pseudomonas aeruginosa infections and colonizations.

Background Info

- Pseudomonas aeruginosa is a common environmental bacteria, normally not harmful to humans.

- Pulmonologically immunosuppressed patients, like Cystic Fibrosis / NCFB and other pulmonary indications, can be susceptible to respiratory P. aeruginosa infection. In these populations, P. aeruginosa is the most harmful pathogen responsible for disease progression, lung function decline, and mortality.

- P. aeruginosa is difficult to treat with antibiotics due to infected patients’ underlying pulmonary disease pathology. It also has inherent and acquired resistance to many antibiotics, strong ability to form biofilms, and has significant genetic versatility.

- An engineered P. aeruginosa “Nuke-a-Monas” phage may provide an effective treatment option.

Project Overview

Step 1: Identify full library of known P. aeruginosa targeting Phages, as well as complete known proteome of Phage library. Also consider proteome / metabolome / excretome of bacterial species competitive or antagonistic to P. aeruginosa, as well as cooperative species.

Step 2: Identify solution space of most-optimal Phage trait characteristics and most-optimal trait combinations, and generate sequences for candidate Phage library across this space.

Step 3: Synthesize candidate Phages and test performance against in-vitro P. aeruginosa cultures.

Step 4: Test final candidate Phages in P. aeruginosa-bearing sputum donor models, as well as in-vivo clinical trials in infected populations.

Step 5: Develop tunable P. aeruginosa Phage platform which evaluates patient-specific culture / isolate, and delivers design of most-effective phage candidate(s) hyper-targeted to the present entities (as well as candidate(s) targeted to predicted drift-entities anticipated to emerge in response to treatment).

Project Aims

Phase #1:

- In-silico design of Phage candidates with anticipated optimal performance qualities.

Phase #2:

- Synthesis of Phage candidates + performance testing via in-vitro P. aeruginosa cultures.

Phase #3:

- Test final Phage candidates via in-vitro clinical trials in P. aeruginosa infected populations.

- Tunable P. aeruginosa Phage platform which can deliver computationally determined Phage candidate(s) with most-effective traits specific to patient culture / isolates. (Alternative to current large library screening approach)

Engineered phage which is hyper-effective at infecting and eliminating Pseudomonas aeruginosa

Trevor Campbell, Cambridge, USA — tdcampnh@gmail.com

81 of 261

Synthetic microbial consortia for coral resilience and thermal tolerance

  • Microorganisms are crucial to any ecosystem’s health (even humans)
  • The “correct” combination of beneficial microorganisms can enhance its resilience to stress (such as climate change)
  • Certain proteins like heat-shock proteins in corals, chaperones or beneficial microorganism’s activities can also be used to prevent the symbiont expulsion and thus, coral bleaching:
    • Antioxidant
    • Quorum quenching
    • Nutrition enhancement

Amparo Saavedra, Santiago, Chile, Genspace

82 of 261

Changing the format of a known binder

Aim: Throughout the pdb, several key therapeutic targets have known binders, these are often Mab’s,peptides/mini proteins etc. Further, papers like BindCraft have demonstrated the ability to generate peptide binders denovo. My goal would be to take a peptide known binder to a protein, graft it to the CDRs of a VHH/nanobody, express and test for binding.

Method:

1. Express EGFR Fragments for yeast/phage display

2. Use in silico design tools to convert a known binder to a VHH

3. Assemble a small library (~10-20) potential VHH CDR3s

3. Test for binding

Karmanya Aggarwal | Cambridge MA | karmanyaaggarwal@gmail.com

83 of 261

Bioluminescent Urban Lighting Fixture & Photobioreactor

Julia Almaraz, Arlington, Texas, USA

The proposed project envisions a bioluminescent urban lighting fixture that functions as a photobioreactor, integrating bioluminescent algae to enhance urban aesthetics and promote sustainability. By incorporating Pyrocystis fusiformis, a species known for its bioluminescent properties, the fixture aims to provide ambient lighting while contributing to environmental health. The algae's photosynthetic activity will absorb carbon dioxide and release oxygen, thereby improving air quality.

The design seeks to create a harmonious blend between urban infrastructure and natural processes, fostering a biodigital aesthetic that reflects a symbiotic relationship with modern ecology. Enhancing the luminescent properties of P. fusiformis through biological optimization of the proteins luciferase and luciferin could further improve the fixture's functionality and visual appeal.

84 of 261

Patrik Artell / Genspace / Lidingö / Sweden / patrikartell@gmail.com

Project Title: Targeting Disorder: AI-Driven Peptidomimetic Design for SIRT6 IDR Modulation in Aging and DNA Repair

Intrinsically disordered regions (IDRs) in proteins have traditionally been considered undruggable, yet they regulate critical functions in aging, cancer, and metabolism. Our project introduces a novel approach to precisely target the IDRs of SIRT6—a key longevity and DNA repair protein—with custom-designed peptides that modulate its function in a structure-informed manner.

Using computational analysis and insights from our MS2 L-protein disorder resilience work, we've designed peptides that target specific functional regions of SIRT6, including its N-terminal regulatory domain and C-terminal chromatin-binding region. These peptides are designed to alter SIRT6's interactions with DNA, influence its recruitment to damage sites, and potentially modulate its role in aging and genomic stability.

Our three-phase implementation strategy progresses from molecular characterization of peptide-IDR interactions (Phase A) to integration with bioelectric signaling (Phase B) and finally to quantum biological measurements (Phase C). This creates a complete framework connecting molecular disorder to quantum effects in a therapeutically relevant context.

The immediate focus is on Phase A experiments at Genspace, where we will validate peptide binding to SIRT6, assess cellular uptake and localization, and measure functional effects on DNA repair processes. This provides a solid foundation for subsequent phases while generating valuable standalone insights into IDR targeting as a therapeutic strategy.

Project Workflow Visualization

  • ┌─────────────────────────┐ ┌─────────────────────────┐ ┌─────────────────────────┐
  • │ PHASE A │ │ PHASE B │ │ PHASE C │
  • │ SIRT6 IDR Targeting │ │ Bioelectric Integration│ │ Quantum Biology │
  • └───────────┬─────────────┘ └───────────┬─────────────┘ └───────────┬─────────────┘
  • │ │ │
  • ▼ ▼ ▼
  • ┌─────────────────────────┐ ┌─────────────────────────┐ ┌─────────────────────────┐
  • │ Computational Analysis │ │ Advanced Biophysical │ │ THz Spectroscopy │
  • │ of SIRT6 IDRs │────▶│ Characterization │────▶│ of SIRT6 Complexes │
  • └───────────┬─────────────┘ └───────────┬─────────────┘ └───────────┬─────────────┘
  • │ │ │
  • ▼ ▼ ▼
  • ┌─────────────────────────┐ ┌─────────────────────────┐ ┌─────────────────────────┐
  • │ Peptide Design & │ │ Bioelectric Monitoring │ │ Quantum Tunneling │
  • │ Twist Order │────▶│ Platform Integration │────▶│ Detection │
  • └───────────┬─────────────┘ └───────────┬─────────────┘ └───────────┬─────────────┘
  • │ │ │
  • ▼ ▼ ▼
  • ┌─────────────────────────┐ ┌─────────────────────────┐ ┌─────────────────────────┐
  • │ Binding & Functional │ │ Correlation with │ │ Integration of │
  • │ Validation at Genspace │────▶│ Cellular Signaling │────▶│ Multi-Scale Data │

└─────────────────────────┘ └─────────────────────────┘ └─────────────────────────┘

Additional Implementation Notes

  1. Peptide Design Rationale:
    • Our C-terminal tail competitor is designed to target the basic patch of SIRT6 (PKRVKAK, residues 345-351)
    • While the peptide itself is acidic (EEEDEEEGEDEEEEE), the region it targets is basic, creating an electrostatic competition
    • This design specifically targets the chromatin binding and nuclear localization functions of SIRT6
  2. Specific Assay Recommendations:
    • For the C-terminal peptide: Perform chromatin fractionation to determine if the peptide causes SIRT6 to be released from chromatin
    • For the N-terminal phospho-mimetic: Measure PARP1 recruitment to DNA damage sites, as the Ser10 phosphorylation is known to enhance this process
    • These assays directly test the mechanistic hypotheses behind our peptide designs
  3. Concentration Optimization:
    • The FITC-labeled tracking peptide will be used to optimize dosage for all peptides
    • Since all peptides share the same TAT cell-penetrating sequence, uptake should be comparable
    • Verification with the FITC tracer will ensure appropriate experimental concentrations

85 of 261

Patrik Artell / Genspace / Lidingö / Sweden / patrikartell@gmail.com

Project Title: Targeting Disorder: AI-Driven Peptidomimetic Design for SIRT6 IDR Modulation in Aging and DNA Repair

Intrinsically disordered regions (IDRs) in proteins have traditionally been considered undruggable, yet they regulate critical functions in aging, cancer, and metabolism. Our project introduces a novel approach to precisely target the IDRs of SIRT6—a key longevity and DNA repair protein—with custom-designed peptides that modulate its function in a structure-informed manner.

Using computational analysis and insights from our MS2 L-protein disorder resilience work, we've designed peptides that target specific functional regions of SIRT6, including its N-terminal regulatory domain and C-terminal chromatin-binding region. These peptides are designed to alter SIRT6's interactions with DNA, influence its recruitment to damage sites, and potentially modulate its role in aging and genomic stability.

Our three-phase implementation strategy progresses from molecular characterization of peptide-IDR interactions (Phase A) to integration with bioelectric signaling (Phase B) and finally to quantum biological measurements (Phase C). This creates a complete framework connecting molecular disorder to quantum effects in a therapeutically relevant context.

The immediate focus is on Phase A experiments at Genspace, where we will validate peptide binding to SIRT6, assess cellular uptake and localization, and measure functional effects on DNA repair processes. This provides a solid foundation for subsequent phases while generating valuable standalone insights into IDR targeting as a therapeutic strategy.

Project Workflow Visualization

  • ┌─────────────────────────┐ ┌─────────────────────────┐ ┌─────────────────────────┐
  • │ PHASE A │ │ PHASE B │ │ PHASE C │
  • │ SIRT6 IDR Targeting │ │ Bioelectric Integration│ │ Quantum Biology │
  • └───────────┬─────────────┘ └───────────┬─────────────┘ └───────────┬─────────────┘
  • │ │ │
  • ▼ ▼ ▼
  • ┌─────────────────────────┐ ┌─────────────────────────┐ ┌─────────────────────────┐
  • │ Computational Analysis │ │ Advanced Biophysical │ │ THz Spectroscopy │
  • │ of SIRT6 IDRs │────▶│ Characterization │────▶│ of SIRT6 Complexes │
  • └───────────┬─────────────┘ └───────────┬─────────────┘ └───────────┬─────────────┘
  • │ │ │
  • ▼ ▼ ▼
  • ┌─────────────────────────┐ ┌─────────────────────────┐ ┌─────────────────────────┐
  • │ Peptide Design & │ │ Bioelectric Monitoring │ │ Quantum Tunneling │
  • │ Twist Order │────▶│ Platform Integration │────▶│ Detection │
  • └───────────┬─────────────┘ └───────────┬─────────────┘ └───────────┬─────────────┘
  • │ │ │
  • ▼ ▼ ▼
  • ┌─────────────────────────┐ ┌─────────────────────────┐ ┌─────────────────────────┐
  • │ Binding & Functional │ │ Correlation with │ │ Integration of │
  • │ Validation at Genspace │────▶│ Cellular Signaling │────▶│ Multi-Scale Data │
  • └─────────────────────────┘ └─────────────────────────┘ └─────────────────────────┘

Additional Implementation Notes

  1. Peptide Design Rationale:
    • Our C-terminal tail competitor is designed to target the basic patch of SIRT6 (PKRVKAK, residues 345-351)
    • While the peptide itself is acidic, the region it targets is basic, creating an electrostatic competition
    • This design specifically targets the chromatin binding and nuclear localization functions of SIRT6
  2. Specific Assay Recommendations:
    • For the C-terminal peptide: Perform chromatin fractionation to determine if the peptide causes SIRT6 to be released from chromatin
    • For the N-terminal phospho-mimetic: Measure PARP1 recruitment to DNA damage sites, as the Ser10 phosphorylation is known to enhance this process
    • These assays directly test the mechanistic hypotheses behind our peptide designs
  3. Concentration Optimization:
    • The FITC-labeled tracking peptide will be used to optimize dosage for all peptides
    • Since all peptides share the same TAT cell-penetrating sequence, uptake should be comparable
    • Verification with the FITC tracer will ensure appropriate experimental concentrations

86 of 261

Biosensing Textiles for Physiological and Environmental Monitoring

Avantika Velho,

Boston, USA

avantikavelho1@gmail.com

86

Aim: This research explores integrating whole-cell biosensors into embroidered textile interfaces for the design of interactive wearables for physiological and environmental monitoring.

Method: In this experiment, I will design biosensor cells in-silico, culture a “placeholder”biosensor bacterial strain (engineered E.coli developed by Joshi Lab), encapsulate the cells in a sodium alginate hydrogel, and deposit them onto textile and biomaterial substrates. Using the Opentrons liquid-handling robot, I will dispense the hydrogel as microdroplets onto embroidered nodes before crosslinking them. Alternatively, I will coat individual threads with the cell-laden hydrogel and crosslink them to create uniform bioactive fibers and then embroider them. I will assess bacterial growth from fluorescence expression (via cuminic acid induction).

Schematic Project Overview

87 of 261

Biosensing Textiles for Physiological and Environmental Monitoring

Avantika Velho,

Boston, USA

avantikavelho1@gmail.com

87

Aim: This research explores integrating whole-cell biosensors into embroidered textile interfaces for the design of interactive wearables for physiological and environmental monitoring.

Lit Review:

Cai, L., Wang, L., Yu, Y., Zhao, W., & Rogers, J. A. (2024). Stitched textile-based microfluidics for wearable devices. Nature Communications, 15, Article 11599943. https://pmc.ncbi.nlm.nih.gov/articles/PMC11599943/

Kim, H., Patel, R., Zhang, X., & Balakrishnan, V. (2024). Advances in textile-based microfluidics for biomolecule sensing. Biosensors and Bioelectronics, 206, Article 11410389. https://pmc.ncbi.nlm.nih.gov/articles/PMC11410389/

Sahoo, A. K., Mishra, B., Nayak, S. K., & Ray, S. S. (2021). A review of textile-based electrodes developed for electrostimulation. Textile Research Journal, 91(1–2), 3–26. https://doi.org/10.1177/00405175211051949

Liu, Y., Kirell, R., Andrews, E., & Voigt, C. A. (2024). Integrating bioelectronics with cell-based synthetic biology. Nature Reviews Bioengineering, 2, 1–15. https://www.nature.com/articles/s44222-024-00262-6

Hudson, T. W., Liu, S. Y., Schmidt, C. E., & Boland, T. (2014). Composite living fibers for creating tissue constructs using textile techniques. Advanced Healthcare Materials, 3(12), 1931–1941. https://pmc.ncbi.nlm.nih.gov/articles/PMC4233137/

Aim 1:

  • In-silico design of biosensor - optimised for chromoprotein output + electron output (bioelectronic integration) and increase binding affinity to cellulose

Aim 2:

  • Encapsulate “placeholder” bacterial biosensors (engineered by Joshi Lab) in sodium alginate hydrogel and integrate onto substrates (textile fibers/ biosed materials)
  • Evaluate and categorise the cell viability and performance with fluorescent microscopy ( after induced)

Aim 3:

  • Create a wearable interface
  • Automate and optimise manufacturing using Opentron.

88 of 261

Teddy Toussaint | Genspace | Cambridge, US | teddy@isibute.com

Background

As in silico design of proteins and other components of biology become more common, faster to produce, cheaper, and more accurate, there may be increased pressure to work through a growing backlog of experiments to verify designs in a manner that is cost-effective and timely. On one hand, we cannot afford to build out the number of labs it would take to keep up with the backlog of experiments required to validate computer generated designs. On the other hand, when each experiment might validate the safety and efficacy of a new life saving drug or lead to the better biomanufacturing of a much-needed commodity that is in short supply, we can not afford not to build out the lab infrastructure needed to validate our new biodesigns. This is why the development of lab-on-a-chip is so important. A lab-on-a-chip is a device that is able to perform one or more laboratory tasks (part of or whole experiments) on a space that ranges from square millimeters to a few square centimeters rather than the 10’s of square feet required for the smallest labs or 100K square feet need for the largest. The savings in real estate, consumables, and labor enabled by lab-on-a-chip could help us get through the backlog of experiments that could form with the improvement of in silico design without breaking the bank.

Aim 1

Attempt to design and fabricate lab-on-a-chip that can take in bacteriophage DNA as an input, transform it into E. coli, and perform and evaluate plaque assay.

Aim 2

Use lab-on-a-chip designed in aim 1 to increase throughput of HTGAA to test MS2 designs of all students.

Aim 3

Just as whole several thousand square foot computer mainframes from the late 1900’s are replaced by the computational power in your smartphone. Replace massive labs with a series of portable chips.

89 of 261

RhizoAlert:

A fluorescent biosensor for monitoring the health of your houseplants

Millions of people around the globe love plants and try to grow their own indoor plants in their apartments or houses… but unfortunately, many end up watching them wither and die without ever realizing the plant was missing some essential care.

I propose to modify Pseudomonas fluorescens, a species of rhizobacterium that inhabits many houseplants’ roots, with a genetic circuit that allows it to respond to abscisic acid (ABA), a plant stress hormone, and express red fluorescent protein (RFP) which, when combined with UV light of a specific wavelength, would allow users to detect early signs of stress in their precious plants, and be able to respond to it before it’s too late.

César Rubio, Santiago de Chile, cesar.rubio@ug.uchile.cl | Notion Page

AIM 1: Construct and clone a genetic circuit that enables Pseudomonas fluorescens to express RFP in response to the plant stress hormone abscisic acid (ABA).

AIM 2: Engineer Pseudomonas fluorescens with the designed circuit and validate its viability, colonization, and ABA-responsive RFP expression in both in vitro and plant-root environments.

AIM 3: Demonstrate the functionality of the biosensor under different plant stress conditions and evaluate its safety and practical implementation as a consumer-friendly home plant care kit.

90 of 261

Lifefabs Institute

91 of 261

A Cell-Free Split-GFP Biosensor for the PARP1–HPF1 Interaction

Constantin Convalexius

Lifefabs · HTGAA 2026 · Remote

Abstract

Yücel et al. (2025) identified 9 conserved master regulators of reprogramming-induced rejuvenation. The catalytically-dead EZH2-Y726D mutant rejuvenates via non-canonical scaffolding rather than enzymatic activity. Whether this generalizes is unknown — but testing it requires a tool that doesn't yet exist for the other 8 regulators. This project builds that tool for one of them: a cell-free split-GFP biosensor for the PARP1cat–HPF1 interaction. Three Twist clonal genes (PARP1cat WT, PARP1cat E988K mutant, HPF1 partner) are co-expressed in Ginkgo Cloud Lab CFPS with sfGFP1-10/GFP11 reporting on binding. The biosensor itself is the deliverable. A WT-vs-E988K comparison is included as a first-pass application of the biosensor. The full scaffolding-hypothesis test across all 9 regulators requires this pipeline as a foundation and would be future work.

Innovation & significance of future work

Innovation: first systematic wet-lab test of whether the catalytic-dead-with-scaffolding-intact phenotype generalizes beyond EZH2.

Significance: if confirmed, establishes PPI-targeting as a universal paradigm for rejuvenation drug discovery — replaces OSKM gene therapy with small molecules.

Background

Yücel et al. 2025 (bioRxiv): reconstructed GRNs across 3 partial-reprogramming systems. 9 conserved master regulators. EZH2-Y726D rejuvenates — WT does not.

Yang et al. 2023 (Cell): DZNep (catalytic EZH2 inhibitor) does NOT prevent chemical rejuvenation → druggable target is the PPI/scaffold, not the catalytic pocket.

Suskiewicz et al. 2020 (Nature): HPF1 docks PARP1 catalytic domain via NAD⁺-independent C-terminal peptide → ideal partner for a scaffolding test.

EZH2

PARP1

01 Design & synthesis

Construct design + cell-free order

Design 3 protein constructs (PARP1cat WT 662–1014, PARP1cat E988K, HPF1 full-length) with split-GFP tags and His6 purification handles. Order from Twist Bioscience as codon-optimized clonal genes in pET-blank T7-lacO-RBS vector.

Deliverable: 3 sequence-verified plasmids, $532

02 Express + Read (was vorher Validation):

Co-express each WT/mutant + HPF1 partner in Ginkgo Cloud Lab CFPS (E. coli BL21 Star lysate, 384-well, 30 °C × 48 h). Read split-GFP fluorescence on Spark plate reader as PPI proxy. Echo-MS QC on 5 % wells confirms protein expression.

Deliverable: working biosensor + WT/mutant signal comparison

03 In silico modeling

Structural mapping & future extension

AlphaFold3 prediction of WT vs E988K PARP1cat-HPF1 complex provides structural context for the biosensor signal. Pipeline scales to remaining 7 master regulators in v2 (BRCA1-BARD1, SMC3-SMC1A, etc.)

What this experiment cannot resolve: One PPI measurement in E. coli lysate does not test catalytic activity (separate enzymatic assay needed), reprogramming potential in living cells (separate cell-based study), or generalization of the scaffolding hypothesis across all 9 regulators (would need 5+ biosensors). This project builds the foundational tool; full hypothesis testing is future work.

References

- Cabantous et al. A New Protein-Protein Interaction Sensor Based on Tripartite Split-GFP Association. Sci Rep 3, 2854 (2013).

- Yücel & Gladyshev (2025) bioRxiv 2025.11.27.690899

- Yang et al. (2023) Cell Suskiewicz et al. (2020) Nature

- Cabantous & Waldo (2005) Nat Biotechnol

- UniProt P09874 (PARP1) / Q9NWY4 (HPF1)

92 of 261

Engineering HLA-G Protein for Enhanced Immune Tolerance and Reduced Graft Rejection

Folasewa Abdulsalam, Ramat-Gan, Israel|Lifefabs Institute|abdulsalammaryam381@gmail.com

93 of 261

Holly Adams, Barcelona, Spain - hollyadams2804@gmail.com

Living Second Skin

Protective Garment Grown from Genetically Engineered Microorganisms / Extremophiles

Providing a barrier between extreme external environmental conditions that could be generated from climate change and global warming

Cale Harrison | London, UK | Notion link | csh237@cornell.edu

94 of 261

Sustainable Bio-Engineered Leafware: Plates & Lunchboxes

Problems:

  • Single-use plastic contributes to pollution and waste.
  • Paper cups and takeout boxes use plastic liners = non-biodegradable.
  • Existing biodegradable materials lack heat and water resistance.

Solution:

  • Strong, water-resistant, and heat-tolerant biodegradable plates.
  • Uses renewable banana and lotus plant sources.
  • Scalable with tissue culture and synthetic biology.

Methods:

  • Engineer banana leaves for increased cellulose and lignin = stronger structure.
  • Introduce lotus genes for hydrophobic wax = water resistance.
  • Add heat-shock proteins + cross-linked cellulose = heat resistance.
  • Incorporate antimicrobial peptides to prevent spoilage.

Irendra Wijewardana, Utrecht, The Netherlands | Lifefabs | irendraw1@gmail.com

Benefits:

  • 100% biodegradable and compostable.
  • Plastic-free solution for takeout and food packaging.
  • Heat- and moisture-resistant for practical use.

I received a comment from Digby to think more about the other applications of this material. I am working on that.

95 of 261

96 of 261

Living Second Skin

Genetically engineered extremophiles grown into a biotextile for climate protection

Bioresponsive textile grown to the shape of the body from microorganisms that have adapted to survive in extreme environments - allowing for a eco barrier between us and the developing harsh climate. The second skin could also provide data about the environment through colour or pressure changes. Could this extremophile be encapsulated into a vessel allowing it to generate energy for the user as a byproduct of the harsh climate..

Holly Adams, Barcelona, Spain - hollyadams2804@gmail.com

Aims:

  • Identify organism whose growth can be simplified for textile manufacturing in a controlled environment

  • Identify organism adaptation that I want to focus on expressing through a textile

  • Research feasibility/success rate of this biomaterial… if we were growing a thermophile would it actually protect us from extreme heat?

97 of 261

ENHANCING VOC DEGRADATION FOR INDOOR AIR QUALITY

Why: Reducing volatile organic compounds (VOCs) improves indoor air quality and decreases risks of irritations, asthma, and sometimes cancers.

Previous studies: Neoplants applied directed evolution to improve natural bacterial capabilities for breaking down benzene and toluene

CHLOE LEE | LONDON, UK | chloelee0207@gmail.com | Notion page

My approach: Genetically engineer bacteria to enhance VOC degradation

  • Aim1: Edit (existing) toluene/benzene dioxygenase gene in Pseudomonas putida.
  • Aim2 (or 1B): Transform bacteria and quantify benzene degradation.
  • Aim3: Map and edit catabolic pathways for multiple VOCs (benzene, toluene, xylene); Inoculate plant roots and measure indoor benzene levels; Experiment with different plant species; Genetically engineer the plants?

98 of 261

Self-dyeing of cellulose yarns using engineered bio-production of dyes.

Juan Pablo Guzman Alvarez | (Notion page) | juanpguz0709@gmail.com

How to Grow Almost Anything 2025 - London node, LifeFabs, UK.

The dyeing process is the most water-consuming step in the fabrication of a garment. Also, current industrial dye manufacturing relies on fossil fuels to cope with current demand. Bacterial dyes have proved potential to reduce dependency of fossil fuels in the supply chain and has successfully allowed the bio-production dyes (see Colorifix, Pili, Huue)

Regenerated cellulose has proved having a high potential for textile circularity by allowing to recycle waste textiles. Regenerated cellulose is manufactured through wet spinning of a cellulose pulp solution. My hypothesis is to modify the bacteria (or engineer the proteins directly) in a way that to allow growth in the pulp that can dye the thread in the manufacturing process.

Aim 1 - What I can do now with HTGAA:

Engineer the enzymes required in the bio-production of a selected dye and introduce them in a particular strain producing cellulose to reduce the thermal and pH sensitivity.

Aim 2 - Foreseeable future

Prototype the cellulose pulp solubilization process and embedding the engineered biologics testing for viability.

Aim 3 - The vision

Scaling up self-dyed garment production until reaching industrial scale.

​​

99 of 261

Machoka Richard, Nairobi, Kenya | Lifelabs Institute | richmachoka@gmail.com

100 of 261

Target snake: Dendroaspis polylepis

  • Highly venomous
  • Kills in a very short time - 30 min
  • Neurotoxic
  • Ubiquitous in Kenya

Target snake venom component

Dendrotoxin 1

  • Unique to Dendroapis genus
  • Constitutes over 60% of venom
  • Part of the Kunitz-type protease

>1DEM_1|Chain A|DENDROTOXIN I|Dendroaspis polylepis polylepis (8620)

QPLRKLCILHRNPGRCYQKIPAFYYNQKKKQCEGFTWSGCGGNSNRFKTIEECRRTCIRK

101 of 261

Principle: Digital fabrication to control biological growth, using computational design to influence how and where the biological agent colonizes the structure.

Possible application:

Design a scaffold with variable porosity or integrated nutrient reservoirs that guide mycelium growth.

Aim 1: Develop an algorithmically generated CAD model of a scaffold designed to support and guide the growth of biological agents. If feasible, create an initial prototype to demonstrate the concept and explore how mycelium colonizes different textures and geometries.

Aim 2: Advance from conceptual modeling to a functional prototype using engineered mycelium-based material, tested in a real-world environment for a specific application e.g. shoe.

Aim 3: Establish a company that manufactures consumer products using living materials, bringing biohybrid design to everyday applications.

Tommaso Silluzio / Berlin / Germany / tom.silluzio@gmail.com

Smith, R.S., Bader, C., Sharma, S., Kolb, D., Tang, T., Hosny, A., Moser, F., Weaver, J.C., Voigt, C.A., & Oxman, N. (2019). Hybrid Living Materials: Digital Design and Fabrication of 3D Multimaterial Structures with Programmable Biohybrid Surfaces. Advanced Functional Materials, 30.

Neighbour-sensing model. In Wikipedia, The Free Encyclopedia. Retrieved 18:33, March 20, 2025, https://en.wikipedia.org/w/index.php?title=Neighbour-sensing_model&oldid=1183319541

102 of 261

Alaa Ali Elshazely,Giza,Egypt | Lifefabs Institute | alaaalielshazely@gmail.com

Genetic Circuit design for Self-Amplifying Immune Enhancement

The project aims design a genetic circuit that could detect and sense early immune signals like the inflammatory cytokines and in response it express immune-stimulatory molecules like the IL-12 which activate the immune response.

Project Workflow

  • Phase 1 : Promoters and Effectors selection
  • Phase 2 : Circuit Design
  • Phase 3 : Circuit Assembly

103 of 261

Computational predictive modeling for ADHD treatment response

Objective: Develop a computational model predicting methylphenidate response in ADHD using multi-omics data.

Methodology:

1.Genomics: Incorporate DRD4 and SLC6A3 polymorphisms.

2.Proteomics: Use AlphaFold to predict dopamine transporter structure and simulate drug binding.

3.Neuroimaging: Integrate fronto-striatal fMRI connectivity metrics.

Tools & Techniques:

Machine Learning: SVM/Random Forest for baseline models; Graph Neural Networks (GNNs) for advanced modeling.

Data Integration: Federated learning for secure multi-site data pooling.

.

Sharvani Togata, kurnool, India, committed listener, life fabs node, sharvani.togata@gmail.com

Aim 1: Build a baseline computational pipeline using existing datasets and tools.

Aim 2: Develop a robust multi-omics predictive engine

Aim 3:Establish a global precision psychiatry platform for ADHD treatment optimization.

104 of 261

BioFlex Muscle Repair Patch: Enhanced Muscle Recovery Patch with Cell Engineering

u | | Lifefabs | vanesazabalo5656@gmail.com

Status Quo:

Muscle injuries, particularly hamstring strains, are prevalent in both athletes and the general population. In the Premier League's 2024–25 season, 24% of injuries were hamstring-related, with many leading to absences exceeding 30 days. (theguardian.com) Recovery times vary based on severity; mild strains may improve within days, while severe cases can take months. (Verywell Health) Notably, studies have found that hamstring strains have a 34% chance of recurrence within the same season. This high recurrence rate underscores the need for more effective and responsive treatment options to enhance muscle repair and prevent re-injury.

Objective:

Design a muscle regeneration patch using engineered cells to produce growth factors that accelerate athletic injury recovery and enhance muscle repair.

Concept:

  • Modify muscle stem cells (satellite cells) using CRISPR/Cas9 or other gene-editing tools to secrete myogenic and anti-inflammatory factors (e.g., IGF-1, IL-10, and VEGF).
  • Incorporate genetic circuits that allow cells to respond to mechanical cues, triggering growth factor release when muscle strain is detected.

Biodegradable:

  • Design a biocompatible scaffold using materials like collagen, chitosan, or PLGA that mimics the extracellular matrix (ECM).
  • Ensure the scaffold is degradable over time, providing support during the critical repair phases and allowing new tissue growth to integrate seamlessly.

Smart Responsiveness:

  • Integrate mechanosensitive promoters to enable cells to increase growth factor production in response to muscle stress or injury.
  • Develop a system that adjusts release rates based on the severity of the injury, ensuring targeted and personalized therapy.

Delivery Method:

  • Apply the patch directly to the injury site during surgery or as a minimally invasive outpatient procedure.
  • Use a hydrogel coating to protect the engineered cells during implantation and facilitate their diffusion into damaged muscle fibers.

105 of 261

Archana Merla, London, UK // archana.merla@gmail.com

LifeFabs

Mycelium-Infused Toilet Paper for Wastewater Bioremediation

Problem + Objective

Pharmaceutical pollution is a growing crisis in the UK, with antidepressants, painkillers, antibiotics, and diabetes medications detected in 52 out of 54 rivers, harming ecosystems and contributing to antimicrobial resistance (AMR). Traditional wastewater treatment plants lack the enzymes to break down these pollutants, requiring a decentralized bioremediation approach.

FLUSHED is a bioengineered toilet paper infused with mycelium that activates upon flushing, using fungal enzymes to metabolize pharmaceuticals, hormones, and heavy metals in wastewater. By embedding remediation into a routine hygiene practice, FLUSHED provides a passive, scalable, and biodegradable solution to reduce water contamination.

What Can I Do Now In HTGAA

Explore mycelium strains capable of pharmaceutical degradation, focusing on white-rot fungi that produce laccases, peroxidases, and hydrolases.

Test different embedding methods for incorporating mycelium into toilet paper, including liquid culture infusion, mycelium-infused cellulose, freeze-dried mycelium layers, and electrospun mycelium fibers for controlled activation.

Foreseeable Future

Encapsulation technology to keep mycelium dormant until FLUSHED, ensuring controlled activation and longer shelf life. Additionally, I will experiment with genetically modified or selectively cultivated fungi to enhance pharmaceutical degradation efficiency.

106 of 261

Archana Merla, London, UK // archana.merla@gmail.com

LifeFabs

Bacterial-Driven Responsive Textiles

Problem + Objective

Current smart textiles rely on synthetic actuators, conductive coatings, or embedded circuits, which are energy-intensive, rigid, and non-biodegradable. They often require external power sources, limiting their sustainability and long-term viability, while also contributing to e-waste due to complex electronic components.

Biologically integrated textiles offer a self-sustaining, adaptive, and biodegradable alternative by using living bacteria as nanoactuators. Potential materials : bacterial cellulose, hydrogel-embedded microbes, or protein-based actuators.

This project aims to develop a bacterial-driven textile that uses biofiber actuators or nanoactuators to respond to light, humidity, airflow, pH, and biological signals by changing shape, stiffness, porosity, or color. Potential applications include self-ventilating wearables, wound-responsive bandages, breathable automotive interiors, and adaptive building facades. By offering a biodegradable, scalable alternative to conventional electronic-based smart fabrics, this project envisions a new paradigm for living, adaptive textiles.

https://skhadrao.cargo.site/RISDxHMG

107 of 261

108 of 261

Ethylene scavenging living materials for fruits preservation

Problem: 50% of food waste is fruits and vegetables.

Ali Khazem, Saarbruecken, Germany, Lifefabs, Ali.Khazem@leibniz-inm.de

Ethylene degrading biosticker

Freshness prolonged

Aim 1: Identify compatible microorganism

Aim 2: Develop metabolic pathway for ethylene degradation

Aim 3: Design biosafe sticker

109 of 261

Using E.coli to produce benzyl acetate from PET

  • Benzyl acetate is used in perfume/cosmetic production for its jasmine/pear smell, and is naturally synthesized in jasmine, hyactine, quince fruits, ylang-ylang…

Aims:

  • create a genetic circuit/perform a Gibson assembly in E.coli to produce benzyl acetate from PET
    • Image on the right shows the potential pathway of synthesis from phenylalanine (created in Galaxy SynBioCAD)
  • Further modeling would allow for the optimization of the pathway, potentially creating de novo enzymes with enhanced biosynthetic performance
  • The pathway could potentially be split into two reactions, to allow for the diversification of the fragrance compounds which could be produced from PET, which could simplify the automation of their production on an industrial scale

PET

Benzyl Acetate

Hana Urukalovic, Lifefabs, London, UK - hana.urukalovic@gmail.com

110 of 261

ALEKSANDR K. LONDON UK | LIFEFABS

info@aleksandk.co.uk

BIO-ENGINEERING PLATFORM FOR DISTRIBUTED FUNCTIONS�Construct synthetic consortia and program their behaviors for biotechnological applications

BIO-TOOLKIT

CONCEPT & APPLICATIONS

Biotechnologies

  • DNA Assembly
  • CRISPR/Cas9
  • Genetic Circuits
  • DNA Memory

Bio-tools

  • Intercellular Signaling
  • Exogenous Inputs
  • Syntrophic Interactions

Framework to program microbes to perform distributed tasks.

Quorum sensing systems can be used to coordinate coordination between organisms linking the production of a signaling molecule with corresponding receptors and promoters controlled by predesigned genetic circuits.

REFERENCES

Applications

  • Biocomputing and distributed tasks execution using division of labour
  • Biosensing, or biofilm productivity

111 of 261

ALEKSANDR K. LONDON UK | LIFEFABS

info@aleksandk.co.uk

AIM-1 Express GFP in-vivo/in-vitro via synthesis of AHL molecule

AIM-1: GFP & QS in vitro (Cell Free System)

LuxI – enzyme that synthesizes the QS molecule (AHL)

LuxR – transcription factor that binds AHL and activates the promoter

Design to express GFP:�- pLux promoter driving sfGFP

- RBS

- sfGFP

- Terminator

AIM-1.1: GFP & QS in vivo (E.coli)

Repeat the experiment but using e.coli

112 of 261

ALEKSANDR K. LONDON UK | LIFEFABS

info@aleksandk.co.uk

AIM-2, AIM-3

AIM-2: DNA Memory

AIM-3: “Leader” Election

113 of 261

Jon Somerscales, London/Bristol, UK (Lifefabs) jtsomerscales@gmail.com

(Generated with MidJourney)

Touch-me-not (mimosa pudica) biosensor button

A protein potentially involved in the touch-based reaction of the Touch-me-not plant (Generated with Swiss Model)

  • What could a biosensor react to on the human touch? - could it sense anxiety, stress, other things, from simply a touch?

  • What about sensing different endangered species?

AIM 1: Identify key mechanisms and propose a feasible design to affect them using synthesis

AIM 2: Implement

AIM 3: Scale up the biosensor impact in areas of health and biodiversity

114 of 261

Next-Generation Synthetic Neural Circuits in Living Cells

What if cells could implement neural networks?

Rizik et. al (2022) asked the same question, as such an advancement could result in unprecedented synthetic and programmable processing and decision-making in living cells. In this spirit, they created the first implementation in living cells: the perceptgene

However, this implementation has multiple limitations, including:

  • Slow dynamics (as it depends on transcription-translation)
  • Not easily scalable due to the nature of the components
  • Not compatible with a “learning” protocol
  • Not robust to various stresses and adverse environments (as it depends on transcription-translation machinery), so it will have limited deployability
  • Imposes a high burden on the cell

Gaston Castillo Moro / Cordoba, Argentina / Lifefabs Institute, UK / gaston.castillom22@gmail.com

What if we can generate the next-generation of neuromorphic circuits based on designable, programmable & modular protein-protein interactions to overcome these limitations?

Aims:

  • Design Modular Protein Nodes: using state of the art computational protein design, generate modular proteins that interact and act as the nodes in my neural network
  • Develop a protein-protein interaction based synthetic neuromorphic circuit using these MPNs
  • Create a mathematical model and simulation to probe the behaviour of my novel circuit architecture and demonstrate programmable neuromorphic computing

115 of 261

Mona E.coLisa - Bioart platform

Aims:

  1. Choose competent bacteria and design genetic circuits for different colour expression

  • Utilise Gibson Assembly for fluorescent and colour-changing genetic circuits, protein folding and visualisation simulations (Alphafold, PyMol), 3D bioprinting - custom petri dishes and (possibly) opentrons for pipetting atomisation

  • Sustainable pigment production by competent bacteria (efficient production scaleup, pigment stability, toxicity, regulatory considerations; collaborations with sustainable designs and cosmetics)

Mikhail Bagirov, Maastricht, the Netherlands

m.bagirov@student.maastrichtuniversity.nl

Lifefabs Node, UK

116 of 261

117 of 261

Paula Rojas, Bogotá, Colombia | LIFEFABS

parojasguerrero@gmail.com

Bioremediation and biosensor for the reuse of rainwater/ wastewater

Objective:

Develop a biological system for detecting and degrading pollutants in rainwater and wastewater, making it safe for reuse in urban and rural settings.

Problem:

Water scarcity | Water pollution in rural areas | Climate change | Global warming | Pollution in rainwater

Aim 1: Immobilize Laccase protein for bioremediation. Engineering a enzymatic system capable of detecting and degrading at least one common water pollutant. Validate enzymatic activity and biosensing capabilities in a controlled experimental setup.

Aim 2: Optimize the bioremediation system by integrating multiple enzymes (e.g., laccase, peroxidases, cytochrome P450) into a functional biofilter.

Aim 3: Transform the technology into a scalable, modular water purification system that combines biosensors and bioengineered remediation for use in cities and rural communities. Develop portable or infrastructure-integrated biofilters for decentralized water treatment.

Mycelium pods - RISD researchers

Algae tiles - UCL

Fungi with Laccase enzyme

118 of 261

119 of 261

Extending Bee Lifespan – A Gateway to Understanding Longevity

Alexandru-Eugen Ioana, CL, Lifefabs Node, Timisoara, Romania, alex.46262@gmail.com

Increased lifespan for a whole new generation of bees in a colony in a isolated environment.

Aim 1: One colony (short-term)

Aim 2: Healthier apiary (medium-term)

Larger and more resilient population, scaling “the diet” to the whole apiary.

Aim 3: Human implications (long-term)

Explore human longevity links, testing MRJP1’s anti-aging potential across species.

Worker and queen larvae share the same DNA, yet queens live years while workers last 6 weeks. The difference? Diet. We will replicate key royal jelly proteins, MRJP1 (for longevity) and royalisin (for immunity) via PCR and Gibson Assembly to administer them to adult bees, not larvae, to avoid caste changes.

120 of 261

AI-GENERATED mRNA SEQUENCES FOR IN-CHIP RANDOMISED CRISPR-CAS13 MEDIATED MUTATIONS AND DE-NOVO IN SILICO SYNTHESIS OF ANTIBODY PARATOPES FOR METASTATIC CANCER RADIONUCLIDE-BEARING IMMUNOTHERAPY IN SILICO EVOLUTION AND DESIGN ENHANCEMENT.

HTGAA 2025 - Student: Federico Brunello - Naples, Italy - London Node - Email: federico.brunello-pharmatech@unina.it

PROBLEM STATEMENT: Immunotherapy in metastatic tumors is not always effective due to the immune escape of tumoral cells.

Constant mutations of tumoral cells can cause emergence of mutations causing resistance to treatment and metastasis. It is important to be able to devise AI-powered tools that can generate a set of randomly mutated antibodies which, based on the structure of existing immunotherapeutics, may be rapidly adapted to the constant epitope profile evolution of cancer cells, maximizing each treatment efficacy.

OBJECTIVE: to design a microfluidic device embedding CRISPR-CAS13, used to randomly insert AI-generated de novo synthesized mRNA sequences onto the mRNA sequences obtained off the paratopes (antigen-recognising areas) belonging to immunotherapeutics currently being used onto the patient. To translate the barcoded paratopes edited mRNA into proteins via ex vivo ribosomes embedded into the microfluidic chip and to assess the target affinity and specificity via quantum dots, and, finally, to functionalize the de novo generated antibodies with radionuclides or toxic compounds to selectively kill the cancerous cells. To perform directed evolution of randomly mutated anti-cancer antibodies so as to constantly be able to find paratopes mutations that are able to challenge the cancer cells mutations.

AIM 1: to identify the right sets of CRISPR-CAS13 and high processivity ribosomes to perform in-vitro RNA mutations and in vitro translation of antibody paratopes mRNA sequences. To implement a randomized mRNA sequence design and synthesis system, and to devise a multi chamber microfluidic chip fo in-vitro CRISPR-CAS13 mediated RNA insertions and translation of in silico edited paratorpes sequences. To identify, reverse-translate and synthesize the mRNA sequences of anti-cancer paratopes in existing anti-cancer antibody-based therapies

AIM 2: to build and test the microfluidic device and the ability of CRISPR-CAS13 to successfully introduce random RNA insertions within the mRNA of existing anti-cancer paratopes. To confirm synthetic ribosomes are able to successfully translate with the required fidelity and processivity the random mRNA insert and paratope mRNA complexes. Test the processivity of the fusion process between the paratope and the remaining part of the antibody, as well as the ability to functionalize the antibody with a quantum dot.

AIM 3: to assess the ability of the de-novo mutated antibodies to bind to the cancerous cell, to successfully screen within a microfluidic chip chamber on-target and off-target mutants, to functionalize the therapeutic antibodies and test them onto mutated cancer cells. To provide a feedback system allowing for the refinement of AI-generated mutations using successful Ab mutants as a training set for directed evolution.

121 of 261

AI-GENERATED mRNA SEQUENCES FOR IN-CHIP RANDOMISED CRISPR-CAS13 MEDIATED MUTATIONS AND DE-NOVO IN SILICO SYNTHESIS OF ANTIBODY PARATOPES FOR METASTATIC CANCER RADIONUCLIDE-BEARING IMMUNOTHERAPY IN SILICO EVOLUTON AND DESIGN ENHANCEMENT.

HTGAA 2025 - Student: Federico Brunello - Naples, Italy - London Node - Email: federico.brunello-pharmatech@unina.it

Background: among the key hallmarks of cancer (Weinberg et al, 2022) is the ability of tumoral cells to mutate and to evade immune destruction. As random genome mutations in cancer cells generate unpredictable epitope profile landscape alterations, the ability to predict and rapidly respond to the emergence of neoepitopes is paramount in order to successfully treat cancer with biologicals (Shiliang Ji et al., “Large-scale transcript variants dictate neoepitopes for cancer immunotherapy”.Sci. Adv, 2025). As random mutations accumulate within the cancer tumoral mass during immunotherapy treatment, some cells may be able to survive the treatment, leading to tumor relapse.

Goals and rationale: In this project, the combined effects of AI design of mRNAs, CRISPR-CAS13 random RNA insertion mutations and in vitro translation are harnessed within a microfluidic chip to generate synthetic mutations in the structure of antibody paratopes.and to subject them to an in-chip directed evolution process, to rapidly evolve a potential therapeutic candidate that may respond to emerging mutations. In-vitro mutated paratope mRNAs are translated in vitro within the microfluidic chip and then fused to the antibody non-variable structures. Neo-synthesized antibodies are bound to Quantum Dots and tested on cancer cells for their ability to bind to de-novo mutated cancer cells with the aid of a cytofluorimeter. Successful candidates are attached with cytotoxic or radionuclides and tested for their efficacy in treating tumoral cells bound onto a microfluidic chip.

Step by step process:

  1. Random mRNA sequences are randomly designed by AI and synthesized chemically.
  2. Paratope mRNA sequences of known antibody treatments for the specific line of cancer are introduced in a microfluidic chip, with CRISPR-CAS13 and ribosomes for downstream translation of the mutated mRNA complex.
  3. Microfluidic chip-bound CRISPR CAS-13 performs random mRNA insertion into the paratopes mRNA sequences.
  4. Mutated paratopes mRNAs are moved to another chip chamber and in vitro translated by ribosomes into paratope proteins, they are then fused to the non-variable structure of the therapeutic antibody to form a new edited therapeutic antibody candidate.
  5. A Quantum Dot and a barcoding are attached to the de novo synthesized antibodies which are tested against a biopsy of cells from the patient. Successfully binding neo-synthesized antibodies are sorted via cytofluorometry and then armed with a radioactive nuclide or cytotoxic compounds and tested for efficacy on a cell culture, successful random mutation designs are fed back to the RNA design for Directed Evolution of mutations in synthetic antitumor antibodies formulation.

122 of 261

Overview: A biodegradable skin patch ("tattoo") that changes color when estradiol levels in sweat rise, signaling the approach of ovulation. By providing a non-invasive fertility indicator, this empowers users with body awareness and reproductive autonomy, without relying on invasive devices or third-party data storage.

Elsa Donovan | Paris, France | Lifefabs | elsa.k.donovan@gmail.com

SomaSignal: Bio-Tattoo for Fertility

Aims:

  1. Design optimized estrogen-binding protein or aptamer that could trigger a color response when detecting estradiol hormone. �Create a biomaterial to be used for the skin patch (alginate or chitosan hydrogel.)
  2. Synthesize the estrogen-binding aptamer in a lab or express and purify estrogen-binding protein and begin phase of testing. Contain the aptamer/protein in the patch.
  3. Refine the visual color indicator using chromoproteins or ph-responsive dye. Assemble all components together into one bio-sensor. Mass produce the bio-tattoo after rigorous testing.

Components: estradiol detection mechanism, biodegradable patch, visual color indicator

123 of 261

124 of 261

ioana ferariu, bucharest, romania : lifelabs : notion : ioana.fery@gmail.com

purePeel

the fruit detox spray

coolBiome

the cooling probiotic

breatheWear

the misting fabric

a probiotic supplement that helps your body naturally tolerate and manage heat better, reducing heat stress and keeping you cooler for longer

a bioactive rinse that removes pesticide residues and harmful chemicals from fruits & vegetables before you eat them—leaving you with produce that’s as clean as organic

a bio-responsive textile that mimics sweating—absorbing body heat and releasing moisture to cool you down, just like human skin does

engineered Lactobacillus strains → produce heat shock proteins (HSPs) in body → help cells withstand higher temperatures

temporary biofilm → made of engineered bacteria or enzymes → bind to and break down pesticides

→ wash with water

fabric fibers → infused with engineered microbial biofilms → secrete cooling hydrogels or evaporative fluids → based on body temperature

125 of 261

Describe expression problem

Enzyme to produce, source organism, required cofactors, pH, Temperature, pressure, RedOx potential…

Not every enzyme can be produced in existing systems…not everything can grow in a Petri dish

Time for upgrade

Tweak the chosen system - describe the features to modify, genes to add, conditions to use for growth and expression for the maximum yeld of the enzyme/protein of interest

Generate a protocol, add steps to enhance the automation - bind protein folding and design tool for functions lacking in expression system…Sugerate how Opentrons could be use to handle complicate pippeting

Choosing the best existing expression system

Weight the constraints and choose the best commercially available expression system.

Victor Baerle, Kraków, Poland

victorbaerle@gmail.com

Lifefabs Node

03

01

02

126 of 261

Andrita Orbandi/London, England, UK/LifeFabs/andrita.project@gmail.com

Enhancing photoprotective ability of bacterial nanocellulose by inducing engineered L-Tyrosine enzyme to kickstart melagonesis of Eumelanin

Aim 1

Run a co-culture protocols of bacterial nanocellulose and engineered yeast

  • Growing BC pellicles of Komagataeibacter rhaeticus (gram negative) with sterilised HS Media
  • In Silico - Incorporate the engineered yeast S. cerevisiae enzyme or engineered Tyr-1 from Bacillus megaterium within the growing nanocellulose matrix (Computational Modelling)

Aim 2

  • Wet Lab - Incorporate the engineered yeast S. cerevisiae enzyme or engineered Tyr-1 from Bacillus megaterium within the growing nanocellulose matrix
  • Trigger oxidation process with chemical buffers
  • Harvest the pellicle, expose to light stimuli with a control and different light intensities (Visible light, UVA, UVB).
  • Observe the production of melanin and the change in tensile strength

Aim 3

  • Design a rotary disc bioreactor in a closed-system manner with multiple control channels for fresh HS-media input, engineered bacteria input, pH meter, and other related sensors for scale up
  • Further test for its UV-protection ability and its relation to the increase in material structural strength

127 of 261

Ayça Esma Subaşi, İstanbul, Türkiye, Lifefabs Node, aesubasi.tr@gmail.com

Genetic Protection in Space:

Modeling Solutions for Astronaut Health

Methodology: Computational Modeling Approach

Simulation of Problems:

  • DNA Damage & Repair Modeling → Predicting mutation rates and repair efficiency under space conditions.
  • Mitochondrial Function & Oxidative Stress Simulation → Analyzing metabolic disruptions and ROS (reactive oxygen species) accumulation.
  • Telomere Dynamics Modeling → Assessing telomere shortening rates and potential protective interventions.

Computational Solutions:

  • CRISPR-Cas9 Efficiency Simulations → Predicting target specificity and off-target effects in space-exposed cells.
  • Epigenetic Regulation Models → Simulating gene expression changes under microgravity and radiation.
  • Gene Therapy Optimization → Virtual testing of gene delivery methods for enhanced cellular adaptation.

Astronauts face serious genetic risks during space missions due to exposure to microgravity and radiation. These conditions can damage DNA, affect cells, and speed up aging, which may harm their health and mission success. This project focuses on developing a computer model to better understand these genetic challenges and explore potential solutions. By analyzing the effects of space conditions on the human genome, this research will help develop ways to protect astronaut health and make their bodies more resistant to space conditions.

Project Phases:

  • Phase 1: Problem Identification – Simulate the impact of microgravity and radiation on DNA integrity and cellular function.
  • Phase 2: Intervention Simulation – Test various genetic treatments

(CRISPR-Cas9, epigenetic modifications, gene therapy) to observe their effects on mitigating genetic damage.

  • Phase 3: Roadmap Development – Analyze simulation outcomes to establish the most promising strategies for protecting astronaut health.

128 of 261

129 of 261

Developing a probiotic drink against uropathogenic E.coli

Vaginal Suppository

  • Increase in antibiotic resistance in uropathogenic bacteria.
  • Uropathogenic E.coli (UPEC) - >80% of cases
  • Possible link between the gut microbiome and uropathogens -> lower gut microbiome diversity show increased UTI susceptibility
  • Balancing the gut microbiome and prevention of UTIs?

Main goal: Modify probiotic strains to express mannose-like receptors that competitively bind UPEC’s FimH adhesins, preventing attachment to bladder cells.

  • Identify what probiotic strains outcompete/inhibit UPECs, as well as prebiotics (D-mannose, cranberry extract)
  • Determine “ideal cocktail” of probiotics and assess survival through GI-like conditions. (co-culture assays with UPEC and bladder epithelial cells)

Lactobacillus strains (found in the vaginal microbiome) to produce antimicrobial peptides that kill or block uropathogenic bacteria

Clara Costea, Warwick, UK- claratheocost@gmail.com

130 of 261

Engineering the Skin Microbiome: Boosting Wound Healing

FINAL PROJECT IDEA

Problem: For people suffering from particular medical conditions (e.g. Type II diabetes, hemophilia, etc.), small deep wounds are often healed very slowly and risk infection by pathogens. Also, extensive skin injuries resulting from burns or chemicals can be lead to significant water loss and leave the body’s interface with the environment unprotected for hours to days.

Aim 1: A) Investigating the physiology of wounds in normal, hemophilic, and diabetic individuals and choosing the target population of patients for which the therapy will be designed. B) Finding or creating a model of the natural human skin microbiome along with its major actors. B) Designing transformation vectors for the expression of recombinant Factor VIII (for hemophilia A patients), acidic metabolites (for lowering pH), immunostimulants/immunomodulators (e.g. flagellin proteins), and/or growth factors (e.g. Wnt/Beta-catetenin agonists), using BioBrick genetic circuit parts and SBOL in the process. C) (Might be skipped/modified) Metabolic modelling of the transformed strains, focusing on their function or pathways of interest. D) Systems modelling of the cross-talk between the native species and the newly-introduced or engineered strain. SBML, COPASI, or Python may be the methods of choice.

Aim 2: A) Implementing the single and consortium-based microbiome engineering design using murine, porcine, or cell culture biosystems, assessing each of the proposed designs in Aim 1 for their predicted efficacy vs. their real-world systems-wide effects on the skin microbiome with the inclusion of positive (i.e. healthy) and negative (i.e. wounded) controls. B) Finding and investigating efficient modes of delivery, such as biocellulose (BC; produced by the Komagataeibacter spp.) dressing integrations or other hydrogels.

Aim 3+: A) Trying to formulate a long-term engineering approach (e.g. engineering commensals like S. epidermidis) as well as a short-term topical solution (e.g. using Lactoplantibacillus plantarum). B) Personalizing the therapy by using adaptable neuromorphic genetic circuits like perceptgene in the engineered microorganisms. C) Integrate/switch to protocellular/cell-free systems for noise-free genetic circuit function and greater biosafety. D) Deliver phage therapies or mycoviral therapies as an alternative. E) Create textile-integrated, cell-free microbiome modulators for rapid healing bondages. F) Create solutions for melanoma prevention, skin rejuvenation, smell modulation, acne reduction, and cancer therapies.

Kourosh Afshinjoo | LifeFabs Node | kshafshinjoo@gmail.com

Native commensals

Introduced strains

Propionibacterium acnes

Staphylococcus epidermidis

Corynebacterium amycolatum

Lactobacillus reuteri

Lactoplantibacillus plantarum

Target population

Strain selection

In silico design

In silico systems modelling and response prediction

Biosecurity design

131 of 261

Cellsius

San Francisco

132 of 261

133 of 261

134 of 261

135 of 261

136 of 261

Muhamad Muhamad Alkriz, Biotechnology, University of Aleppo, Syria, muhammadkriz22@gmail.com

Esraa Alkhalil, Biotechnology, University of Aleppo, Syria, esraaalkhalil2000@gmail.com

Targeting EpCAM Using Phytochemicals: A Structure-Based Drug Discovery Approach

EpCAM as a Cancer Marker: EpCAM is overexpressed in many epithelial cancers and plays a key role in proliferation and metastasis, making it a promising therapeutic target.

Data Analysis and Visualization

Top 8 compounds were analyzed via BIOVIA for interaction profiles; 4 were selected based on hydrogen bonding and stability, supported by CASTp pocket mapping.

Tools and Workflow

We docked 30 phytochemicals from PubChem to EpCAM’s N-terminal domain (PDB: 4ZMV) using AutoDock Vina after preparing ligands and protein with Open Babel and AutoDock Tools.

Next Steps and Extensions

ADMET analysis and MM-GBSA scoring will further assess drug-likeness and binding strength; future experimental validation is planned.

Objective of the Idea: This study aims to identify potential phytochemical inhibitors targeting the N-terminal domain of EpCAM, a cell surface protein overexpressed in various epithelial cancers. Using a structure-based drug discovery approach, 30 plant-derived compounds were selected from PubChem and screened via molecular docking (AutoDock Vina) against the EpCAM structure (PDB: 4ZMV). The objective is to highlight lead compounds with favorable binding energies and multiple interactions with key residues. This computational screening provides a foundation for future experimental validation and supports the development of natural, targeted therapies against EpCAM-expressing tumors.

137 of 261

Quantum Computing & AI for Endometriosis

Cindy Catherine Orbegoso-Barrantes, Cambridge(UK). Lifelabs, London

cindycatherine.orbegoso@gmail.com

  • No single biomarker exists, making AI-driven multi-omics analysis a strong candidate.

  • Computational models + quantum computing can optimize biomarker discovery, predict treatment response, and reduce diagnosis time.

Problem statement

Aim:

Predict endometriosis using gene expression data and compare classical AI models with quantum-enhanced models (Quantum SVM).

Phases:

  1. Data Collection & Preprocessing�Gather and clean gene expression data (including ERα).
  2. Feature Extraction�Extract relevant features from the gene data.
  3. Model Development�Apply classical ML and Quantum SVM models.
  4. Comparison & Evaluation�Compare model performance (accuracy, precision, recall).
  5. Interpretation & Conclusion�Analyze results and draw conclusions.

138 of 261

Developing mRNA vaccines and assessing their immune efficacy for treating

Wafaa Aldarwish, Idleb, Syria | Bioclub London | wafaa.aldarwish.2002@gmail.com

139 of 261

140 of 261

László Cseresznyés, Lisbon, Portugal�laszlo.cseresznyes6@gmail.com

LIFELAB�LONDON

SENSEABLE STRESS

Measuring stress VOC of humans and plants

- > Urban design and policy making�- > Awareness�- > Art

I.�Engineering basic genetic circuit in bacteria:

extracellular receptors - > concentration in cytoplasm - > expression of gene

II. �Engineering complete genetic circuit:

VOC receptors - > protein synthesis of chromoprotein��III.�Urban installation:�Visible - sensitive - safe�

141 of 261

André Trindade, Lisbon, Portugal�andre@bytheendofmay.com

LIFELAB�LONDON

Reishi mushrooms as air quality sensors

Reishi mushrooms grow differently according to CO2 concentrations

>2000 ppm: fruit as antler-like formations�<800 ppm: develop normal caps�

I.�Modifying genetic circuit to be sensitive to local range of CO2 concentration

II.�Modifying genetic circuit to be reactive to other pollutant particles or introducing bacteria that respond to these. �

III.

Integrating it to urban objects, surfaces or growing new urban structures�(Bus stops, benches, etc)

142 of 261

Engineering an HIV Vaccine with AI-driven Neoantigen Discovery & Design

Leonardo de la Parra | Monterrey, Mexico | Lifefabs Institute, UK | leodelaparra1@gmail.com

  • Aim 1: Identify novel, highly immunogenic HIV peptides using AI-based MHC-binding prediction models (DeepImmuno, NetMHCpan), rank them and predict the structures of the candidates using AlphaFold.

  • Aim 2: Enhance and stabilize antigen structures with RF diffusion, optimize scaffold structures and adjuvant combinations, and test top-ranked candidates in vitro and in vivo.

  • Aim 3: Scale the discovery platform for mass production of the HIV vaccine and develop real-time antigen prediction to adapt the vaccine for emerging HIV variants.

Overview: HIV remains a major global health challenge due to its rapid mutation rate and immune evasion strategies. This project aims to use deep learning models to identify HIV neoantigens, optimize them with stabilizing scaffolds and potent adjuvants for the development of a next-generation vaccine.

MHC binding prediction

Novel peptides

143 of 261

144 of 261

145 of 261

Genetically Modified Plants for Phytoremediation of Heavy Metals

Why?

Heavy metal contamination, especially mercury (Hg²⁺), is a major environmental issue.Traditional phytoremediation is slow and limited by plant tolerance. Animals need something to eat while we clean the soil. If we upload plants that do not have mercury, animals will not bioaccumulate it. Its important to clean and support the areas affected by mercury pollution as well as their native flora and fauna.

How?

We will insert a transcriptional construct of the Mer operon with some modifications. The Mer operon comes from mercury-resistant bacteria and allows the reduction of oxidized mercury to elemental mercury, which is its less toxic form. We will truck the experiment with the expression of GFP.

Alejandro Menca Castellanos (AMC) | Spain | Alejandro.Mena1@alu.uclm.es

Figure 2. Schematic representation of the implementation of heavy metal transporters to the extracellular space, creating a circuit where the cell absorbs heavy metals, typically via co-transporters of assimilable light metals such as calcium, potassium, and sodium. This diagram illustrates the regulation of low mercury concentrations in a soil contaminated by the heavy metal. The protein generated through genetic editing functions to export mercury ions present in the cytoplasm.

Figure 1. Confocal images show GFP-ATM1

(IQ-tail) distribution on lateral root. Golomb, Lior & Abu-Abied, Mohamad & Belausov, Eduard & Sadot, Einat. (2008).

146 of 261

Genetically Modified Plants for Phytoremediation of Heavy Metals

Alejandro Menca Castellanos (AMC) | Spain | Alejandro.Mena1@alu.uclm.es

Figure 2. Schematic representation of phytoremediation strategies used by plants to mitigate mercury contamination. The diagram illustrates mechanisms such as mercury uptake by roots, translocation to shoots, and detoxification processes including chelation, compartmentalization, and enzymatic reduction to elemental mercury.

Figure 1. Confocal images show GFP-ATM1

(IQ-tail) distribution on lateral root. Golomb, Lior & Abu-Abied, Mohamad & Belausov, Eduard & Sadot, Einat. (2008).

147 of 261

Alejandro Menca Castellanos (AMC) | Spain | Alejandro.Mena1@alu.uclm.es

Figure 4: Materials used in floral dip transformation. Adapted from Scientific Journal of Biological Sciences, 2023,

Genetically Modified Plants for Phytoremediation of Heavy Metals: Walkthrough

Figure 3: Schematic representation of the mer operon and its function in mercury resistance. In the presence of mercury, the mer operon is activated, leading to the expression of genes responsible for mercury detoxification. This process involves the reduction of mercury to its less toxic form, which is then retained within the cell, preventing further damage.Adapted from Scientific Journal of Biological Sciences, 2023,

148 of 261

Alejandro Menca Castellanos (AMC) | Spain | Alejandro.Mena1@alu.uclm.es

Genetically Modified Plants for Phytoremediation of Heavy Metals: Walkthrough

Figure 5. Decrease in absorbance at 340 nm indicating the oxidation of NADPH to NADP⁺ during the enzymatic reduction of Hg²⁺ to elemental mercury (Hg⁰) by the MerA enzyme from the mer operon. The rate of NADPH consumption is proportional to the amount of Hg²⁺ present in the reaction. Soderberg, T. (2016). Monitoring Hydrogenation and Dehydrogenation Reactions by UV Spectroscopy. In Organic Chemistry with a Biological Emphasis (Vol. 2.0).

Figure 6. Representation of the protein MerA surface in PyMOL. Residues near cofactors are highlighted in red, while potential cavity-forming residues are shown in blue. The analysis identified five theoretical binding pockets.

149 of 261

Figure ref: Kwak, S.-Y., Giraldo, J. P., Wong, M. H., Koman, V. B., Lew, T. T. S., Ell, J., Weidman, M. C., Sinclair, R. M., Landry, M. P., Tisdale, W. A., & Strano, M. S. (2017). A Nanobionic Light-Emitting Plant. Nano Letters, 17(12), 7951–7961. https://doi.org/10.1021/acs.nanolett.7b04369

Cell-free Luciferase system for brighter bio-lighting

Defne Karagul, LifeFabs, London, UK

defnekaragul@gmail.com

In 2017, Kwak et al. made nanobionic luciferase plants that gave dim lighting for up to 4 hours, which could eventually replace electric lighting.

Why go cell-free?

  • Minimise the transfer of genetic information to other organisms
  • Achieve higher concentrations of luciferase
  • Freedom create brighter mutants without toxicity consideration

Aim 1: express the luciferin-luciferase system in a cell-free framework

Aim 2: introduce mutations that would achieve brighter reactions

Aim 3: incorporate photosynthetic machinery so that the system can provide its own energy

I will also use Gaussia luciferase instead of firefly luciferase because this is an ATP-independent luminescence system, therefore the energy can be saved purely for DNA replication, transcription and translation.

150 of 261

151 of 261

ScentCapsule: A Paper-based Scent Generator

AIM 1 (Scent Designer)�Develop a computational model to design biological circuits that produce specific scents.

AIM 2 (The ScentCapsule)

Develop a Cell-free paper based device with a porous mesh acting as scent memory, multiple compartments to store/ produce different scents, and an activation method to trigger scent release.

A portable device for storage and release of custom scents on demand. Leveraging genetic circuits and cell-free based expression.

Youssef Abdelmaksoud | Paris, France, yosefmhmod@gmail.com | Lifelab

Image created with Playground

152 of 261

🔹Conventional exosomes contain uncontrolled bioactive molecules, posing risks of inflammation, tumorigenesis, and infection.� 🔹 Solution: Engineered Exosomes – precisely modified to deliver targeted molecules to Dermal Papilla Cells (DPCs) for enhanced hair regeneration.

Customized cargo (growth factors, miRNA, proteins) to stimulate DPC function�Elimination of harmful components (inflammatory cytokines, tumorigenic factors)� ✅ Enhanced targeting for specific uptake by DPCs, ensuring localized action

Engineering Exosomes for Hair Loss – Targeting Dermal Papilla Cells

Kasidet Khimnae , Berlin , Germany

flyfframa11@gmail.com

153 of 261

Why Targeting DPCs with Engineered Exosomes?

🔬 Challenges with Natural Exosomes

  • Unpredictable composition → variable therapeutic effects
  • Non-specific action → risk of side effects

🚀 The Engineered Exosome Advantage

  1. Precise molecular cargo selection → miRNA & proteins that directly activate Wnt/β-catenin and Shh pathways in DPCs
  2. Enhanced safety → removing inflammatory or unwanted signals
  3. Targeted delivery → ensuring efficient uptake by DPCs for optimized follicle regeneration

🔍 Future Directions:

  • Engineering exosomes with DPC-specific ligands for enhanced targeting
  • Preclinical & clinical validation for safe, effective hair loss treatment

  • To develop engineered exosomes that specifically target Dermal Papilla Cells (DPCs) for enhanced hair follicle regeneration.
  • To ensure safety and efficacy by controlling the molecular cargo, eliminating harmful components, and optimizing targeted delivery.

154 of 261

Project Proposal: Spirulina-Based Bio-Active Wearables and Regenerative Textiles

Auda Sakho, Lifelab nodes, London, UK

infoaudadesignsite@gmail.com

Spirulina (Arthrospira platensis), a nutrient-dense cyanobacterium, is renowned for its high protein content and bioactive compounds. Recent advancements suggest its potential in developing sustainable, bio-active textiles that not only serve functional purposes but also contribute positively to the environment.

Objectives:

• Bio-Active Wearables: Develop textiles capable of releasing oxygen, absorbing CO₂, and delivering skin-nourishing nutrients.

• Regenerative Fashion: Create spirulina-based textiles that are biodegradable, returning nutrients to the soil, thus supporting a circular fashion system.

2. Bio-Active Wearables

Concept:

Integrate living Spirulina cells into textiles to harness their photosynthetic ability, enabling CO₂ absorption and oxygen release. Additionally, utilize Spirulina’s bioactive components to promote skin health.

Key Project Goals:

1. Develop a functional spirulina-polymer composite

• Experiment with different formulations, such as spirulina biomass + PLA/PHA.

• Optimize mechanical properties (flexibility, strength, biodegradability).

155 of 261

Sustainable Bio-Interactive Wearable Sensors

This fabric has multiple potential applications:

Applications:

Health Monitoring Wearables: Embedding biological sensors in fabric to track health indicators like heart rate, body temperature, and pH levels.

Sustainable Biomaterials: Using biodegradable materials (e.g., bacterial cellulose) to create eco-friendly smart fabrics in fashion.

Aims:

Aim 1: Develop a biological sensor that can be integrated into clothing to monitor sweat pH levels using electrochemical, bio-fluorescent, or color-changing mechanisms.

Aim 2: Enhance sensor performance to create smart fabrics with wireless data transmission capabilities.

Aim 3: Build a sustainable brand combining fashion, health, and technology. This involves creating customizable smart clothing lines for different user groups like athletes, patients, and fashion consumers. Additionally, improving the production of eco-friendly, biodegradable, and renewable smart fabrics.

Serenity,Lifefabs,London,UK

svea_xuzhihan@126.com

156 of 261

157 of 261

LAST SLIDE

LIFEFABS

SLIDE DECK

158 of 261

Cellsius Final Projects�SF Node

159 of 261

De Novo designed antivenoms

Implement this paper end to end: https://www.nature.com/articles/s41586-024-08393-x

160 of 261

Bio-Sponge for Targeted Toxin Removal

Concept: A genetically engineered bio-sponge designed to capture and neutralize harmful proteins at a targeted site in the body.

Etai Sapoznik/Cellsius/SF/USA/etai.sapoznik@gmail.com

161 of 261

Bio-sponge Genetic Circuit

Genetic Circuit Components:

  1. Self-assembling scaffold (Ferritin-based or exosome-based)
  2. Modular antibody-binding domains for specificity
  3. External activation (heat, light, ultrasound) for release or degradation

Etai Sapoznik/Cellsius/SF/USA/etai.sapoznik@gmail.com

162 of 261

Bio-Sponge Additional Considerations

Scaffold Choice: avoid aggregation

Ferritin-based – Find a variant with low iron binding

Exosome-based – Using a surface protein (e.g., CD63) for target binding

Target Choice:

SpyTag/SpyCatcher

Nanobody

Etai Sapoznik/Cellsius/SF/USA/etai.sapoznik@gmail.com

163 of 261

The Vision for a healthier Global Microbiome

To create a more balanced, healthier microbiome. To that end, create a communication and visualization interface that tracks individual and global microbiome health and interactions over time. This would include a simpler, cost-effective way to repeatedly diagnose and analyze our biomes. It would help people understand how and which lifestyle changes, interventions, and/or environmental exposures affect their microbiome composition and function, and what they could do to rebalance the biome.

The Project

Focus on the continued health of people’s oral microbiome. Devise a bioengineered probiotic to detect and destroy the main pathogen of the oral microbiome consortium. The human subgingival plaque harbors more than 500 bacterial species. Research has shown that Porphyromonas gingivalis is the major etiologic agent which contributes to chronic periodontitis.

https://pmc.ncbi.nlm.nih.gov/articles/PMC4746253/

Periodontal disease caused an estimated loss of $154.06B in the US and €158.64B in Europe, in 2018. These results show that the economic burden of periodontal disease is significant.

https://pubmed.ncbi.nlm.nih.gov/34053082/

Creating a Bioengineered Probiotic to Detect and Destroy Porphyromonas Gingivalis

Heike Rapp | San Francisco, CA | heike.here@gmail.com

164 of 261

165 of 261

Enhancing carbon sequestration with extremophile genes

‘CHONKUS’ ie. UTEX 3222

OCEAN CARBON REMOVAL

TRANSPLANTING THE CARBON STORAGE GRANULE GENE

Microscopy image of UTEX 3222 via Wyss Institute at Harvard University

THE GOAL?

PROJECT PROPOSAL BY MAKENNA MAHRER

This extremophile cyanobacteria, lovingly dubbed ‘Chonkus’ for its high affinity for carbon storage, has a unique ability to convert ambient carbon dioxide into large carbon storage granules.

First and foremost, I’m interested in identifying the gene(s) responsible for the high sequestration rates in UTEX 3222. Once accomplished, these genes might serve as novel tools to enhance carbon sequestration potentials of terrestrial plants, algae, or other industrial bacteria, with implications for biofuels and other target metabolite production.

The biological carbon pump is naturally adept at sequestering atmospheric carbon dioxide in the deep ocean, and figuring out a way to use this gene(s) to enhance that process safely could have massive impacts in the climate space.

Isolate the gene responsible for large carbon storage granules and achieve transgene expression in a model organism.

https://doi.org/10.1128/aem.00841-24

mmahrer23@cmc.edu

166 of 261

Soylent Genes

Mickey McManus

167 of 261

Space Silk

Mickey McManus

Through synthetic biology a lab in china has now been able to design a silk worm that produces spider silk. Spidroin the protein that spider’s make has enhanced properties beyond classic silk worm fibroin, but has been historically very hard to scale up by convincing cannibalistic spiders to play nice and sit still for milking on industrialized spider farms.

Silk is uniquely biocompatible and water soluble as well as antimicrobial. And if factored in with the strength of spider silk has structural properties. In space we need structures for living and ways to close the loop so that the waste material can be used for other purposes. Space silk may be the secret solution to weaving space habitats. Could we merge a good zero gravity plant or organism with the powers of silk?

168 of 261

Cell free super sensing and personal biome tuning

Mickey McManus

How might we use solid state bioprinting to dramatically increase the sensing of our body’s media?

How might we close the loop to personal biome tuning by building a cell-free bioprinter?

&

169 of 261

170 of 261

171 of 261

Rnai based therapeutics revised

Saad ahmad | Individual project

Dominant-Negative Mutations:

  • In this scenario, the mutant protein interferes with the function of the normal protein produced by the correct gene copy.
  • Example: In Marfan Syndrome, mutations in the FBN1 gene produce defective fibrillin-1 protein, which disrupts the function of the normal fibrillin-1 protein, leading to connective tissue abnormalities.
  • Mutations in the TP53 gene can produce a mutant p53 protein that not only loses its tumor-suppressing function but also interferes with the normal p53 protein.

172 of 261

  • RNA seq of individual
  • Manufacture specific siRNA

SPECIFICITY ISSUE/OFF TARGETING

  • RNA drugs has revolutionized after COVID

173 of 261

Violeta Vilcapoma|Cellsius|Lima| Peru| violeta.vilcapoma@pucp.edu.pe

One of the limitations for colonizing Mars focuses on the living conditions that can be provided, so it is necessary to be able to guarantee the capacity of oxygen that can be generated according to environmental conditions that can vary abruptly.

-> Currently, filamentous fungi, biominerals such as calcium carbonate, and diazotrophic cyanobacteria are used. However, various biopolymers could also be incorporated to filter the Martian environment, retaining only oxygen particles for storage. Additionally, they could contribute to converting Mars' CO₂ into oxygen.

This idea is a nanoparticle-based drug delivery system for immunocompromised patients, could provide targeted and controlled medication release to boost immune responses or modulate immune activity as needed.

-> It seeks to be a controlled drug release system based on nanoparticles designed to encapsulate antivirals or antibiotics, with the aim of regulating and controlling the immune system in immunocompromised patients. In addition, it would be integrated with artificial intelligence (AI) to analyze clinical history and generate predictive immunological markers, allowing personalized dosing and adaptation of treatment in real time.

OxyMars : Biomaterial for Oxygen Production on Mars

ImmunoTher: Drug delivery system for immunocompromised patients

Since cancer is one of the diseases with the highest number of patients in the world, being able to create a microfluidic system in which brain cancer can be detected would be essential and would help reduce health gaps.

-> Idea inspiration:

Augustine R, Aqel AH, Kalva SN, Joshy KS, Nayeem A, Hasan A. Bioengineered microfluidic blood-brain barrier models in oncology research. Transl Oncol [Internet]. 2021;14(7):101087. Disponible en: http://dx.doi.org/10.1016/j.tranon.2021.101087

Microfluidic for cancer detection

174 of 261

Divya Srinivasan | Cellsius

1. Electricity from Bacteria

Inspired by some papers I read, certain bacteria (geobacter sulfurreducens) generate electricity when they feed on acetate, and this could potentially be turned into a sensor of sorts, by engineering the bacteria to generate electrons in a certain condition (such as body temperature, to create a “touch” sensor).

https://www.teresavandongen.com/Spark-of-Life

https://www.dezeen.com/2023/10/02/renewable-biodegradable-power-bacteria/

https://www.electricskin.org/

Microbial biofilms for electricity generation from water evaporation and power to wearables

https://pubs.acs.org/doi/10.1021/acssynbio.9b00506

divya_srinivasan@berkeley.edu

175 of 261

Divya Srinivasan | Cellsius

2. Bacteria Tarot

More of a fun/random experimentation, I was inspired by a project on generating typography from different bacteria that grows/merges traditional and modern Hebrew script together with bacteria (paenibacillus vortex) and its food source. I think it could be an interesting idea for “tarot” where a question/prompt is given in one medium, and fed with another input that then creates a visual that can be interpreted.

https://www.dezeen.com/2015/09/14/ori-elisar-grows-letterforms-lab-using-bacteria-filled-petri-dishes-hebrew/

divya_srinivasan@berkeley.edu

176 of 261

Exploring development of structural predictor focused towards DNA nanostructures

Packaging DNA/RNA into compact shapes to improve cellular uptake and localized delivery

Rolling Circle Amplification to enable largescale self-folding DNA.

While alpha fold has excellent prediction capabilities for proteins it is limited for the prediction of DNA nanostructures as the no. of strands that can be input are limited.

In a sense, DNA nanostructure prediction is theoretically simpler since the primary interaction is only DNA base pairing. Taking sequence complementarity into account should help verify the accuracy further.

This is particularly useful because multiple sets of orthogonal sequences can result in the same structure.

Several works have shown that DNA nanostructures can enhance cellular uptake.

Designing modular structures that can latch on to different strands and act as envelopes to deliver messages (DNA strands) to desired location. The same envelope can be used for different kinds of messages.

Rolling circle amplification creates long repetetive copies of input strands.

Certain strand sequences have the capability of self folding into a variety of shapes.

Choosing the shapes cleverly such that they are capable of assembling further via blunt end stacking or base pairing to further form macroscale assemblies.

This is analogous to primary and secondary structure seen in proteins where the primary structure is that of the building block which interact to form the secondary structures.

Anirudh Sampath, West Lafayette, USA

177 of 261

Arvind Bhallamudi

Cellsius

Interested in using fungi species for plastic bioremediation : including laccases, peroxidases, esterases (like cutinases and lipases), and potentially PETase and MHETase, to break down plastic polymers into simpler compounds.

Examples of fungi species:

    • Aspergillus tubingensis has been identified as breaking down plastic in a landfill.
    • Pestalotiopsis microspora is a type of endophytic fungus discovered in the Amazon rainforest that contains bacteria that can biodegrade and break down synthetic plastic polymers.

178 of 261

SynBioGenetics

179 of 261

180 of 261

181 of 261

182 of 261

183 of 261

Rodrigo Tamayo | SynBioGenetics | CL | Santiago, Chile | rodrigo.tamayo.b@gmail.com

De Novo Production of Brassinosteroids in Yarrowia lipolytica

500 USD 10mg

184 of 261

Rodrigo Tamayo | SynBioGenetics | CL | Santiago, Chile | rodrigo.tamayo.b@gmail.com

Engineered Peptide + Exosomes as a treatment for hair-loss

AR

DHT

185 of 261

Rodrigo Tamayo | SynBioGenetics | CL | Santiago, Chile | rodrigo.tamayo.b@gmail.com

Automatic dispenser of neuromodulators

GABA

Serotonin

Dopamine

186 of 261

Molecular modeling and in silico validation of peptide inhibitors of MDM2-p53 interaction as a strategy to restore p53 antitumor activity in cancer cells.

Cancer remains one of the leading causes of mortality worldwide, largely due to therapies with low specificity and high side effects. One of the key pathways involved in multiple types of cancer is the interaction between MDM2 and p53, where MDM2 blocks the tumor suppressor activity of p53. This project proposes to design inhibitory peptides capable of disrupting this interaction, allowing the restoration of p53 anti-tumor function. Unlike small inhibitors such as Nutlin-3a, computationally designed peptides offer the potential to be more specific, less toxic and customizable, justifying the development of new therapeutic strategies based on artificial intelligence.

Jorge Moreano, Quito, Ecuador.

jluismoreano@gmail.com

Objective

To design and structurally predict peptide inhibitors of MDM2-p53 interaction using generative models and artificial intelligence, evaluating their binding affinity in silico as a basis for future therapeutic applications against cancer.

187 of 261

Vanessa Romero, Quito, Ecuador.

vromero@usfq.edu.ec

188 of 261

189 of 261

190 of 261

191 of 261

192 of 261

Soylent Genes

Through synthetic biology a lab in china has now been able to design a silk worm that produces spider silk. Spidroin the protein that spider’s make has enhanced properties beyond classic silk worm fibroin, but has been historically very hard to scale up by convincing cannibalistic spiders to play nice and sit still for milking on industrialized spider farms.

In the classic 1960’s [science fiction story] (https://en.wikipedia.org/wiki/Make_Room!_Make_Room!) and 1970’s movie Soylent Green the world by the year 2022 was entering a hothouse run away global warming catastrophe combined with overpopulation crisis. The masses were offered a breakthrough new food wafer called Soylent Green made ostensibly of plankton. The company who produced it didn’t actually tell folks that Soylent Green was actually made of people (well that’s one way to get rid of extra humans).

Now that synthetic biologists have created a way to not only make fibroin but also spidroin via silkworms, it made me wonder “how we might dramatically increase the production output of silkworm?” Planting many more mulberry trees and fostering far more sericulture is one approach (and it’s got a triple bottom line in that it sequesters carbon in the soil, provides shade, silk, feed, and fertilizer (when the silk moths or worms die). But that limits us to climates that can support mulberry trees (silk worms have been domesticated over thousands of years to only eat mulberry tree leaves.)

I’d like to actually edit plankton so that they grow white mulberry tree leaves (and or the proteins that provide the signals and nutrients that a silk worm needs to thrive). That way we could create Soylent Gene powered food wafers for silk worms. Silk worms are attracted to the jasmine smell of the white mulberry tree and get all their nutrition from the leaves. By editing plankton to produce silkworm food we can spread the benefits of silk worm production to coastal areas that have abundant sea water, or scale up solar powered bioreactor factories of phytoplankton.

The species of the mulberry tree is called Morus alba, it is diploid and has 28 chromosomes. The species of plankton would be the model organism that has already been well studied for various alternative production methods called Synechocystis.

An Alternative approach would be to edit other fast growing plant species that could provide nutrients to silk worms but that grow in a wider range of climates. In either case we need to consider how to get the key factors that drive silk worms wild with delight when they are given white mulberry tree leaves. Of course if I were taking the movie completely seriously we’d edit the silk worms themselves to love the taste of silk moths and close the loop entirely but my science teachers taught me that perpetual motion machines don’t exist and that cannibalism isn’t nice.

193 of 261

Anahí Ñacato

194 of 261

195 of 261

196 of 261

197 of 261

198 of 261

Production of recombinant Dispersin B to trait Staphylococcus aureus and Pseudomonas aeruginosa Biofilms in a cell-free system

199 of 261

Production of recombinant Dispersin B to trait Staphylococcus aureus and Pseudomonas aeruginosa Biofilms in a cell-free system

200 of 261

201 of 261

202 of 261

203 of 261

204 of 261

205 of 261

206 of 261

207 of 261

1. Self-Assembling Peptides for Cultivated Meat Scaffolding

Objective:

Design self-assembling peptides that form bioactive scaffolds, enhancing cell adhesion, proliferation, and differentiation in cultivated meat. These scaffolds will mimic the extracellular matrix (ECM) and improve tissue maturation.

2. Fetal Hemoglobin for Enhanced Oxygen Transport in Cultivated Meat

Objective:

Engineer and produce fetal hemoglobin (HbF) in yeast to enhance oxygen transport in cultivated meat, improving cell survival and tissue viability.

3. Co-Culturing Cultivated Meat with Probiotic Bacteria for Scaffolding and Antimicrobial Properties

Objective:

Develop a co-culture system integrating probiotic bacteria with cultivated meat to enhance scaffold formation, improve texture, and naturally inhibit microbial contamination, using genetic circuits.

The path towards an accessible Cultivated Meat

María José Méndez, Cali, Colombia m.mendezv97@gmail.com

208 of 261

Mycoplasma Biosensor for cell culture

Present at least one final project idea! Can be more than one if you like :)

Supporting text and images welcome :)

Natalie Edwards, Santiago Chile natalie.edwards@ug.uchile.cl

Mycoplasma spp. is a common contaminant of cell cultures, undetectable to the naked eye and capable of passing through 0.22 µm filters used for culture media filtration. This type of contamination can spread to cell cultures, as it lacks a cell wall and does not respond to antibiotic treatments, affecting cell viability and the integrity of the studies conducted.This contamination is not noticeable to the naked eye, and can be detected when the amount of cells is high.

Detection includes PCR test wich takes several hours and treatment to remove these contaminants include antibiotics, which do not always work and there is a risk treated cultures can always spread contamination. ��Objective: I propose the use of a highly sensitive cell free system biosensor for early detection of contamination to avoid harmful effects in the long run.

209 of 261

210 of 261

211 of 261

212 of 261

Damaris Ganchozo| Guayaquil, Ecuador | Synbio Genetics | damarismichaelle@gmail.com

In vivo monitoring of hydrocarbon contamination in coastal ecosystems

Problem

There are many oil spills in coastal areas where it takes a long time to delimit the affected areas, especially when it gets dark at night.

Solution

The idea relies in the creation of a biosensor module powered by bioluminescent bacteria with the intent of the monitoring and mapping of environmental hazards. Under toxic conditions, the bioluminescence is reduced and can be measured by a luminometer.

Buoys could be deployed in high-risk areas, such as shipping lanes and oil drilling sites, for continuous monitoring.

Aims:

  • Create of a functional sensing genetic circuit able to sense TPH (toluene) traces in water systems.
  • Develop a matrix based on a material that allows the modified bacteria to remain alive for a period of time so they can be visualized.
  • Prototyping a basic electronic module with microfluidics that captures the bioluminescent signals to then be transferred to a database.

More info here

213 of 261

Problem

Babies have a developing immune system, which makes them more susceptible to the ingestion of contaminated food, causing symptoms such as vomiting, diarrhea, fever and their ability to fight pathogens is limited, which increases the risk of serious complications.

Damaris Ganchozo| Guayaquil, Ecuador | Synbio Genetics | damarismichaelle@gmail.com

Solution

Design a skin patch incorporating a biosensor capable of detecting changes in skin temperature and the presence of specific biomarkers associated with rashes (by high levels of histamine) and fever.

Aim 1 Identify a flexible, non toxic material that can adhere to the skin.

Aim 2. Design an enzymatic biosensor based on aptamers, which are DNA or RNA sequences designed to bind to specific molecules, such as histamine, and emit colorimetric signals to detect food poisoning at an early stage.

Aim 3 Create a network cloud where data can be stored and shared in real time with parents and doctors.

BabyPatch: Rapid testing of histamine levels in babies.

More info here

214 of 261

215 of 261

216 of 261

217 of 261

More Informatión Here: https://mini-cotton-2a7.notion.site/FINAL-PROYECT-1b6d9ae1b02a802ca7c6dd0e22f2fece?pvs=4

218 of 261

Victoria Makerspace, BC, Canada

219 of 261

220 of 261

221 of 261

222 of 261

GUSTAVO M. MARCHANI Calgary, AB, Canada | gamm2000.gm@gmail.com

Improved Luz (Fungal Luciferase)

  • Thermostability
  • Better quantum yield
  • Substrate binding

“Fluorescence”-Activated Cell Sorting (FACS)

Use bioinformatics approach to engineer the enzyme to have better qualities and is functional in cytosolic form

223 of 261

Effect of Microgravity on DNA Origami

224 of 261

Development of a DNA Origami System for Targeted Delivery of Doxorubicin in Breast Cancer Cells

  • DNA origami is transforming cancer therapy. It involves folding DNA into custom nanoscale shapes.
  • This allows for targeted drug delivery. It also improves diagnostics and enables personalized treatments.
  • Drugs can be encapsulated within cavities or gaps in the DNA origami structure. For example, a DNA origami “box” can be opened and closed to release its contents in the right place.

Andrea Tambo, La Paz, Bolivia | and.andreatambo17@gmail.com | Victoria Makerspace Node

225 of 261

Andrea Tambo, La Paz, Bolivia | and.andreatambo17@gmail.com | Victoria Makerspace Node

Methodology

Design & Synthesis

    • Design a "box" structure using caDNAno/Tiamat.
    • Assemble DNA origami with scaffold and staple strands.

Functionalization

    • Attach ERα-specific aptamers for targeted delivery.

Drug Loading

    • Encapsulate doxorubicin.
    • Quantify loading via spectrophotometry/HPLC.

Controlled Release

    • Test release at pH 5.5 (tumor) vs. pH 7.4 (normal).

Cytotoxicity Tests

    • Treat MCF-7 (cancer) and fibroblast (healthy) cells.
    • Assess viability with MTT/Trypan Blue assays.

Udomprasert, A., & Kangsamaksin, T. (2017). DNA origami applications in cancer therapy. Cancer Science, 108(8), 1535-1543. https://doi.org/10.1111/cas.13290

226 of 261

Project idea 1: In-Silico Engineering of Cyclin-Dependent Kinase (CDK) Peptide Inhibitors

  • Objective:

Develop small peptide inhibitors for CDKs to regulate cell cycle in cancer cells.

  • Methodology:

Design & Simulation: Use PyMOL & AutoDock for peptide design and docking.

Optimization: Refine peptides using GROMACS simulations.

Validation: Partner with labs for in vitro testing of peptide efficacy.

  • Potential Impact:

Potential Novel therapeutic approach for cancer treatment through targeted CDK inhibition.

Jerome Bright Ogenrwot, Kampala, Uganda. Victoria node.

227 of 261

228 of 261

Designer Cells LabAhmad Hader, Faculty of medicine, Yarmouk university�ahmaduni.a10@gmail.com

Design PAN HLA-I Binder

Why a New HLA‑Class I Binder?

  • HLA system = most polymorphic region of the human genome; displays peptides to T‑cells�
  • Immunopeptidomics reveals disease‑specific peptides but needs lots of sample & expensive antibodies�
  • IMBAS‑MS cut plasma volume to 200 µL yet still relies on biotinylated W6/32 antibodies (costly)

229 of 261

Project Approach & Aims

  • Aim 1 – Design a de novo, Pan‑HLA‑I binder entirely in silico�
    • IPD‑IMGT/HLA database → MAFFT MSA → Jalview consensus�
    • Structure modelling (AlphaFold/ColabFold) & binding‑site mapping (MaSIF, Pesto, ScanNet, bindcraft)�
    • Binder generation/relaxation in BindCraft, followed by docking & AlphaFold‑3 validation�
  • Aim 2 – Express binder & measure affinity (SPR)�
  • Aim 3 – Add biotin tag, couple to magnetic beads, enrich HLA–peptide complexes, validate by MS

230 of 261

Impact & Broader Value

  • Cheaper, easy‑to‑produce binder unlocks routine, patient‑level immunopeptidomics�
  • Improves diagnosis, prognosis & personalised immunotherapy—especially in low‑resource settings�
  • Generates large immunopeptidomic datasets for cancer, vaccine & autoimmune research�
  • Governance goals: safety, equitable access, privacy, cost‑minimisation

231 of 261

Designer Cell Labs, Korea

Xavier Alexandro Rios Salinas

Sucre, Bolivia

xavier.alexandro.rios.salinas@gmail.com

Lithium is a metal used in the production of batteries but also for medical drugs used in psychiatric disorders

Current methods for lithium extraction are large scale water consumption technologies which is a harm for environment, especially for local communities. At the same time, when lithium is used by patients, it has the risk to produce adverse effect by its toxicity, so it needs to be constantly monitored in patient´s serum.

A possible solution for this could be: cell free biosensor of lithium capable of a dual use in biomining and medicine.

EXtended Chemosensory Array for Lateral Ion Biosensing and Ultimate Recovery

“EXCALIBUR”

232 of 261

A riboswitch is a RNA sequence capable of adhering directly to Li+ ions and function as a promoter at translational level.

Dual use?

  • Capable to report Li+ levels in human serum
  • Capable of isolate Li+ with high specificity without using large water resources

https://www.nature.com/articles/s41598-022-20695-6

Designer Cell Labs, Korea

Xavier Alexandro Rios Salinas

Sucre, Bolivia

xavier.alexandro.rios.salinas@gmail.com

233 of 261

Designer Cell Labs, Korea

Xavier Alexandro Rios Salinas

Sucre, Bolivia

xavier.alexandro.rios.salinas@gmail.com

Experimental Design &Methodology

Methodology:

  • .

  1. Riboswitch Design�
    • Use or engineer a Li⁺-sensing riboswitch that activates translation upon Li⁺ binding.
  2. Genetic Circuit Assembly�
    • Construct RNA: [Li⁺ Riboswitch] → [Amplifier(?)] →[Reporter (e.g., GFP/luciferase)].
  3. Cell-Free System Preparation�
    • Use TX-TL (Transcription-Translation) extracts (e.g., E. coli-based PURE system or crude lysate).
  4. Lithium Detection Assay�
    • Add RNA/AA to the cell-free reaction mix.
    • Add varying Li⁺ concentrations and incubate.
  5. Signal Measurement�
    • Measure reporter output (fluorescence/luminescence).
    • Analyze sensitivity, specificity, and dose-response.

234 of 261

Designer Cell Labs, Korea

Hyunseo kwon, Incheon, Korea

kwonhspresent@yonsei.ac.kr

Background Information

Western populations, such as those in the United States and Europe, tend to have a higher abundance of Bacteroides species, which are associated with high-fat, high-protein diets. (1)

In contrast, non-Western populations, such as those in Africa and Asia, often exhibit a higher prevalence of Prevotella species, which are linked to high-fiber, plant-based diets. (2)

These differences are thought to be driven by dietary habits.

Japanese populations have been found to have lower alpha and beta diversity compared to other populations, with a high abundance of Bifidobacterium and a low abundance of potentially pathogenic bacteria. This may be attributed to the unique dietary habits of the Japanese population, which include a high intake of soy, seafood, and fermented foods.(3)

  1. Govender, Priyanka & Ghai, Meenu. (2024). Population-specific differences in the human microbiome: Factors defining the diversity. Gene. 933. 148923. 10.1016/j.gene.2024.148923.
  2. Sheng Y, Wang J, Gao Y, Peng Y, Li X, Huang W, Zhou H, Liu R, Zhang W. Combined analysis of cross-population healthy adult human microbiome reveals consistent differences in gut microbial characteristics between Western and non-Western countries. Comput Struct Biotechnol J. 2023 Nov 28;23:87-95. doi: 10.1016/j.csbj.2023.11.047. PMID: 38116074; PMCID: PMC10730331.
  3. Nakayama, Jiro. (2018). Health status of Japanese and Asians indicated by gut microbiome research. Journal for the Integrated Study of Dietary Habits. 29. 137-140. 10.2740/jisdh.29.3_137.

235 of 261

Designer Cell Labs, Korea

Hyunseo kwon, Incheon, Korea

kwonhspresent@yonsei.ac.kr

Question Mark?! - 1 -

How about difference within Korea?

  1. Microbe composition of the gut was strongly associated with age. … abundance of members of Bacteroidia and Clostridia differed with the host dietary patterns, body mass index, and stool frequency.(1)

  • Lim MY, Hong S, Bang SJ, Chung WH, Shin JH, Kim JH, Nam YD. Gut Microbiome Structure and Association with Host Factors in a Korean Population. mSystems. 2021 Aug 31;6(4):e0017921. doi: 10.1128/mSystems.00179-21. Epub 2021 Aug 3. PMID: 34342532; PMCID: PMC8407462.

236 of 261

Designer Cell Labs, Korea

Hyunseo kwon, Incheon, Korea

kwonhspresent@yonsei.ac.kr

(1) Lim MY, Hong S, Bang SJ, Chung WH, Shin JH, Kim JH, Nam YD. Gut Microbiome Structure and Association with Host Factors in a Korean Population. mSystems. 2021 Aug 31;6(4):e0017921. doi: 10.1128/mSystems.00179-21. Epub 2021 Aug 3. PMID: 34342532; PMCID: PMC8407462.

237 of 261

Designer Cell Labs, Korea

Hyunseo kwon, Incheon, Korea

kwonhspresent@yonsei.ac.kr

Question Mark ?!

How about difference within Korea?

  • Microbe composition of the gut was strongly associated with age. … abundance of members of Bacteroidia and Clostridia differed with the host dietary patterns, body mass index, and stool frequency.(1)

How about relationship with Soil microbiome?

  1. Gut-Soil Axis Exist (2)
  2. From hunter-gatherers to an urbanized society, the human gut has lost alpha diversity. Interestingly, beta diversity has increased, meaning that people in urban areas have more differentiated individual microbiomes.(3)

  1. Lim MY, Hong S, Bang SJ, Chung WH, Shin JH, Kim JH, Nam YD. Gut Microbiome Structure and Association with Host Factors in a Korean Population. mSystems. 2021 Aug 31;6(4):e0017921. doi: 10.1128/mSystems.00179-21. Epub 2021 Aug 3. PMID: 34342532; PMCID: PMC8407462.
  2. Ottman N, Ruokolainen L, Suomalainen A, Sinkko H, Karisola P, Lehtimäki J, Lehto M, Hanski I, Alenius H, Fyhrquist N. Soil exposure modifies the gut microbiota and supports immune tolerance in a mouse model. J Allergy Clin Immunol. 2019 Mar;143(3):1198-1206.e12. doi: 10.1016/j.jaci.2018.06.024. Epub 2018 Aug 7. PMID: 30097187.
  3. Blum WEH, Zechmeister-Boltenstern S, Keiblinger KM. Does Soil Contribute to the Human Gut Microbiome? Microorganisms. 2019 Aug 23;7(9):287. doi: 10.3390/microorganisms7090287. PMID: 31450753; PMCID: PMC6780873.

238 of 261

Designer Cell Labs, Korea

Hyunseo kwon, Incheon, Korea

kwonhspresent@yonsei.ac.kr

FINAL Idea

Soil Microbiome &

Gut Microbiome

Relationship

Gut Microbiome

Relationship within Korean

Final Goal : Understand Interrelation between microbiome to understand �the significance of pathogenesis and progression of human disease

239 of 261

Designer Cell Labs, Korea

Anastasia Arkhipenkova, Incheon, Korea

anastasia.rkh@yonsei.ac.kr

240 of 261

Openbioscience

Ottawa Node

241 of 261

242 of 261

XOS Project: SynBio Enzyme Soil Restoration

What?

Alexander Proaño, La Armenia, Openbioscience Ottawa Node

243 of 261

Why?

244 of 261

How?

In the future?

Advantages

https://www.notion.so/New-individual-project-1d8a68cfac3f8099a476d6696d20fade

245 of 261

Bio Fashion Design - Kate Melanson

246 of 261

247 of 261

248 of 261

249 of 261

250 of 261

251 of 261

252 of 261

Valeria Rodriguez Espinoza�Munich, Germany �valeriarodres@gmail.com

Addressing Pollution from Fabrics

The textile industry is the most polluting industry in Europe, and recycling textiles remains a major challenge due to the complex supply chain and the diversity of materials. Synthetic fibers accounts for 70% of global fiber use, where 9 out 10 are polyester.

While there are solutions for collection and sorting, the biggest leverage point lies in production. What if we would design recyclable and biodegradable textiles from the start?

This project enables the production of textiles that can self-degrade, shifting the current standards of the fashion and textile industries toward a truly circular economy.

This will be achieved by automating the molecular biology, and fermentation steps using Opentrons to produce enzymes capable of breaking down synthetic fibers made out of polyester.

253 of 261

Polyethylene terephthalate (PET) is the chemical name for polyester. Polyester textiles are semi-crystalline monomeric structural units linked by ester bonds. There are some fungal hydrolytic enzymes are capable of breaking down PET like esterases, lipases, cutinases, hydrolases and keratinases.

Cutinases and Estereases are of industrial applications interest because they remain active in the absence of an oil–water interface. Industrial scale has been developed to break down bottles PET into fiber PET, nevertheless textile fiber-to-fiber recycling is still in lab scale—where the major challenges are the energy cost-effectiveness. Therefore, the biggest lever comes at the scale up production.

For this Proof Of Concept, I I will focus on designing an entire fermentation workflow with minimal human assistance using Opentron to scape up to 25 ml. For this I have selected Leaf-Branch Compost Cutinases (EC 3.1.1.74), as it has the ability to break down semi-crystalline PET, and have demonstrated promising results at lab scale. Although this project focuses on cutinases, this technology can be adapted for other enzymes.

How to hydrolyze PET?

Cutinase

Valeria Rodriguez Espinoza�Munich, Germany �valeriarodres@gmail.com

254 of 261

Aim 2

Create a PoC by expressing cutinase into E. coli

Transforming Production for Circular Textiles

Aim 1Design an entire fermentation workflow with minimal human assistance using OPENTRON

Aim 3

Create a Textile PoC by embedding the protein in a fabric.

Valeria Rodriguez Espinoza�Munich, Germany �valeriarodres@gmail.com

255 of 261

Regenerative Therapy for Motor Neuron Recovery in Amyotrophic Lateral Sclerosis

Mariana Valdez, Puebla, México marianavaldez2001@gmail.com

Design a genetic circuit for neural stem cells that promotes:

  • Motor neuron regeneration
  • Axon remyelination in patients with amyotrophic lateral sclerosis (ALS).

The circuit will activate the expression of genes related to neuronal protection and remyelination to slow motor neuron degeneration.

256 of 261

Goal: New enzymes for the Reclone open DNA collections!

T4 Ligase & Bsal

Ethan Itovitch, Montreal, QC

257 of 261

Context

  • Reclone is an organization that aims to make biology more accessible to the public. They have a repository of reagents at: https://github.com/Reclone-org/Open-DNA-Collections. They have multiple open collections for enzymes, bacteria, yeast etc and multiple reagent hubs for making it easy to share DNA, parts & collections.
  • While this is a fantastic initiative, they are missing some crucial pieces to make this truly accessible to the public, T4 ligase & Bsal. These enzymes are crucial for cutting and putting DNA back together

Goal

  • Synthesize T4 Ligase & Bsal to make the Reclone repository more accessible

258 of 261

T4 Ligase

  • T4 Ligase allows you to join DNA fragments together.

Protocol

  • I found the T4 Ligase sequence online
  • We can then insert it into PET-28a(+)
  • transform into E. Coli.
  • Induce the production using skim milk
  • lyse the cells
  • Since the PET-28a(+) contains 6xHis we can extract using IMAC

259 of 261

Bsal

  • Bsal is a little more complicated to synthesize since it could cut the DNA of the host organism. Because of this Bsal needs to be synthesized with BsaIM1 & BsaIM2. The process was described in the following patent which recently expired: https://patents.google.com/patent/US6723546B2/en
  • BsaIM1 & BsaIM2 methylate the sequence that Bsal would cut protecting it from the Bsal being produced

  • Of the three enzymes only Bsal will have the 6xHis tag so we can use the same protocol as T4 Ligase and isolate for Bsal
  • BsaI is a restriction enzyme which cuts DNA and creates overhangs which can be used to piece DNA together

Considerations

Protocol

260 of 261

TdT murine for miRNAs synthesis

Berenice Ferruzca

Querétaro, México

ferruzca.berenice@gmail.com

261 of 261

LAST SLIDE OF THE

COMMITTED LISTENERS

FINAL PROJECT SLIDES